BLASTX nr result
ID: Magnolia22_contig00015515
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Magnolia22_contig00015515 (1078 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value KIW63112.1 hypothetical protein PV04_09988 [Capronia semi-immersa] 77 2e-12 XP_009161532.1 RNA-directed RNA polymerase [Exophiala dermatitid... 74 1e-11 XP_013320042.1 hypothetical protein PV05_03905 [Exophiala xenobi... 73 3e-11 XP_007761518.1 RNA-directed RNA polymerase [Cladophialophora yeg... 70 3e-10 XP_008731815.1 hypothetical protein G647_09290 [Cladophialophora... 70 7e-10 XP_016229034.1 hypothetical protein PV10_01211 [Exophiala mesoph... 67 4e-09 XP_016245931.1 hypothetical protein PV07_08871 [Cladophialophora... 67 7e-09 XP_007734710.1 hypothetical protein A1O3_06400 [Capronia epimyce... 67 2e-08 XP_013271304.1 hypothetical protein Z518_07722 [Rhinocladiella m... 64 4e-08 KIV83843.1 hypothetical protein PV11_05832 [Exophiala sideris] 65 7e-08 XP_018161289.1 Macro domain-containing protein [Colletotrichum h... 63 1e-07 XP_007288587.1 macro domain-containing protein [Marssonina brunn... 62 2e-07 OCT46231.1 LRP16 family protein [Cladophialophora carrionii] 61 1e-06 XP_007785424.1 hypothetical protein EPUS_05783 [Endocarpon pusil... 60 2e-06 KZL69777.1 macro domain-containing protein [Colletotrichum tofie... 59 3e-06 KXH64276.1 macro domain-containing protein [Colletotrichum salicis] 59 3e-06 XP_007751817.1 hypothetical protein A1O5_13059 [Cladophialophora... 59 3e-06 XP_018070835.1 A1pp-domain-containing protein [Phialocephala sco... 59 3e-06 KFY59288.1 hypothetical protein V496_05738 [Pseudogymnoascus sp.... 59 4e-06 XP_008098030.1 macro domain-containing protein [Colletotrichum g... 58 4e-06 >KIW63112.1 hypothetical protein PV04_09988 [Capronia semi-immersa] Length = 235 Score = 76.6 bits (187), Expect = 2e-12 Identities = 33/55 (60%), Positives = 43/55 (78%) Frame = -1 Query: 1078 EVKKFLQQPDGDKIDKVIFCNFMDKDVDAYAEALPYIFPATEEDRKNKDPNEGKI 914 EV FL++P+G K+DKVIFCNF+DKDVDAYAE LP +FP T++D + D EG + Sbjct: 181 EVYTFLRKPEGQKLDKVIFCNFLDKDVDAYAECLPIVFPPTKDDLSHTDRPEGSL 235 >XP_009161532.1 RNA-directed RNA polymerase [Exophiala dermatitidis NIH/UT8656] EHY61071.1 RNA-directed RNA polymerase [Exophiala dermatitidis NIH/UT8656] Length = 235 Score = 74.3 bits (181), Expect = 1e-11 Identities = 31/55 (56%), Positives = 42/55 (76%) Frame = -1 Query: 1078 EVKKFLQQPDGDKIDKVIFCNFMDKDVDAYAEALPYIFPATEEDRKNKDPNEGKI 914 EV FL+ P+G K+DK++FCNFMDKDV AYAE LP I P T++D + +P+EG + Sbjct: 181 EVYSFLRTPEGHKLDKIVFCNFMDKDVKAYAEVLPKILPPTKDDLSHTEPSEGNL 235 >XP_013320042.1 hypothetical protein PV05_03905 [Exophiala xenobiotica] KIW59458.1 hypothetical protein PV05_03905 [Exophiala xenobiotica] Length = 235 Score = 72.8 bits (177), Expect = 3e-11 Identities = 28/55 (50%), Positives = 43/55 (78%) Frame = -1 Query: 1078 EVKKFLQQPDGDKIDKVIFCNFMDKDVDAYAEALPYIFPATEEDRKNKDPNEGKI 914 E FL++P+G K++K++FCNF+DKD+DAYAE LP +FP TE+D + D ++G + Sbjct: 181 ETLAFLKRPEGQKLEKIVFCNFLDKDMDAYAECLPTVFPPTEDDLSHTDNSQGNL 235 >XP_007761518.1 RNA-directed RNA polymerase [Cladophialophora yegresii CBS 114405] EXJ54003.1 RNA-directed RNA polymerase [Cladophialophora yegresii CBS 114405] Length = 226 Score = 70.1 bits (170), Expect = 3e-10 Identities = 30/50 (60%), Positives = 39/50 (78%) Frame = -1 Query: 1078 EVKKFLQQPDGDKIDKVIFCNFMDKDVDAYAEALPYIFPATEEDRKNKDP 929 EV FL++ +G K+DKV+FCNF+DKDV AYAE LP +FP TE+D + DP Sbjct: 172 EVYTFLRKLEGRKLDKVVFCNFLDKDVSAYAECLPIVFPPTEDDLSHTDP 221 >XP_008731815.1 hypothetical protein G647_09290 [Cladophialophora carrionii CBS 160.54] ETI19456.1 hypothetical protein G647_09290 [Cladophialophora carrionii CBS 160.54] Length = 347 Score = 70.5 bits (171), Expect = 7e-10 Identities = 28/44 (63%), Positives = 38/44 (86%) Frame = -1 Query: 1078 EVKKFLQQPDGDKIDKVIFCNFMDKDVDAYAEALPYIFPATEED 947 EV +FL +P+G K+D+V+FCNF+DKDV AYAE LP++FP TE+D Sbjct: 172 EVYRFLTKPEGQKLDRVVFCNFLDKDVTAYAECLPHVFPPTEDD 215 >XP_016229034.1 hypothetical protein PV10_01211 [Exophiala mesophila] KIV97460.1 hypothetical protein PV10_01211 [Exophiala mesophila] Length = 244 Score = 67.0 bits (162), Expect = 4e-09 Identities = 28/44 (63%), Positives = 36/44 (81%) Frame = -1 Query: 1078 EVKKFLQQPDGDKIDKVIFCNFMDKDVDAYAEALPYIFPATEED 947 EV+ FL + DGDK+DK+IFCNF+DKDV AYA+ +P FP TE+D Sbjct: 194 EVRAFLMKSDGDKLDKIIFCNFLDKDVSAYAKHIPTSFPPTEQD 237 >XP_016245931.1 hypothetical protein PV07_08871 [Cladophialophora immunda] XP_016245932.1 hypothetical protein, variant [Cladophialophora immunda] KIW25715.1 hypothetical protein PV07_08871 [Cladophialophora immunda] KIW25716.1 hypothetical protein, variant [Cladophialophora immunda] Length = 263 Score = 66.6 bits (161), Expect = 7e-09 Identities = 27/55 (49%), Positives = 40/55 (72%) Frame = -1 Query: 1078 EVKKFLQQPDGDKIDKVIFCNFMDKDVDAYAEALPYIFPATEEDRKNKDPNEGKI 914 E++ F+ +P G +++K+I CNF+D DVDAY ALP +FP TE+D + P EGK+ Sbjct: 209 EIRTFVDEPTGLQLEKIILCNFVDNDVDAYDSALPLVFPPTEDDLSHTVPLEGKV 263 >XP_007734710.1 hypothetical protein A1O3_06400 [Capronia epimyces CBS 606.96] EXJ82587.1 hypothetical protein A1O3_06400 [Capronia epimyces CBS 606.96] Length = 389 Score = 66.6 bits (161), Expect = 2e-08 Identities = 26/44 (59%), Positives = 38/44 (86%) Frame = -1 Query: 1078 EVKKFLQQPDGDKIDKVIFCNFMDKDVDAYAEALPYIFPATEED 947 EV FL++P+G K++K+IFCNF+DKDV+AYA+ LP +FP T++D Sbjct: 172 EVYSFLKKPEGQKLEKIIFCNFLDKDVEAYAQILPTVFPPTKDD 215 >XP_013271304.1 hypothetical protein Z518_07722 [Rhinocladiella mackenziei CBS 650.93] KIX04168.1 hypothetical protein Z518_07722 [Rhinocladiella mackenziei CBS 650.93] Length = 264 Score = 64.3 bits (155), Expect = 4e-08 Identities = 27/39 (69%), Positives = 33/39 (84%) Frame = -1 Query: 1078 EVKKFLQQPDGDKIDKVIFCNFMDKDVDAYAEALPYIFP 962 EV FL++P+G K+DKVIFCNF+DKDV AYAE LPY+ P Sbjct: 172 EVYAFLERPEGQKLDKVIFCNFLDKDVKAYAEVLPYVSP 210 >KIV83843.1 hypothetical protein PV11_05832 [Exophiala sideris] Length = 421 Score = 64.7 bits (156), Expect = 7e-08 Identities = 28/44 (63%), Positives = 35/44 (79%) Frame = -1 Query: 1078 EVKKFLQQPDGDKIDKVIFCNFMDKDVDAYAEALPYIFPATEED 947 EV FL++P+G K+DKVIFCNF KDV+AY E LP +FP TE+D Sbjct: 181 EVYAFLKKPEGQKLDKVIFCNFTGKDVEAYKEFLPILFPPTEDD 224 >XP_018161289.1 Macro domain-containing protein [Colletotrichum higginsianum IMI 349063] CCF36450.1 macro domain-containing protein [Colletotrichum higginsianum] OBR12772.1 Macro domain-containing protein [Colletotrichum higginsianum IMI 349063] Length = 249 Score = 62.8 bits (151), Expect = 1e-07 Identities = 32/78 (41%), Positives = 46/78 (58%) Frame = -1 Query: 1075 VKKFLQQPDGDKIDKVIFCNFMDKDVDAYAEALPYIFPATEEDRKNKDPNEGKI*PRSHA 896 V+ FL DGDK+DKVIFC F KDV+AY EALP FP ++ K ++G + A Sbjct: 172 VRDFLDGEDGDKLDKVIFCTFEMKDVNAYNEALPVFFPPPDQTAAPKQTDDGP--TQEQA 229 Query: 895 RDLDDVSRTIPPVLRSRP 842 + D ++ +P V ++ P Sbjct: 230 DEADAIAAELPSVPKTDP 247 >XP_007288587.1 macro domain-containing protein [Marssonina brunnea f. sp. 'multigermtubi' MB_m1] EKD21585.1 macro domain-containing protein [Marssonina brunnea f. sp. 'multigermtubi' MB_m1] Length = 288 Score = 62.4 bits (150), Expect = 2e-07 Identities = 28/46 (60%), Positives = 34/46 (73%) Frame = -1 Query: 1075 VKKFLQQPDGDKIDKVIFCNFMDKDVDAYAEALPYIFPATEEDRKN 938 VK FLQ DGDK++KVIFC F+ KDVDAY + LP FP+TEE + Sbjct: 176 VKDFLQAKDGDKLEKVIFCTFVSKDVDAYNKWLPRFFPSTEESESD 221 >OCT46231.1 LRP16 family protein [Cladophialophora carrionii] Length = 368 Score = 60.8 bits (146), Expect = 1e-06 Identities = 24/37 (64%), Positives = 32/37 (86%) Frame = -1 Query: 1078 EVKKFLQQPDGDKIDKVIFCNFMDKDVDAYAEALPYI 968 EV +FL +P+G K+D+V+FCNF+DKDV AYAE LPY+ Sbjct: 172 EVYRFLTKPEGQKLDRVVFCNFLDKDVTAYAECLPYV 208 >XP_007785424.1 hypothetical protein EPUS_05783 [Endocarpon pusillum Z07020] ERF77214.1 hypothetical protein EPUS_05783 [Endocarpon pusillum Z07020] Length = 359 Score = 60.1 bits (144), Expect = 2e-06 Identities = 32/83 (38%), Positives = 47/83 (56%), Gaps = 8/83 (9%) Frame = -1 Query: 1078 EVKKFLQQPDGDKIDKVIFCNFMDKDVDAYAEALPYIFPATEEDRKNKDPN--------E 923 EV+ FL PDG+ I++V+FC+F KDV+AY E LP FP T++D + + + + Sbjct: 166 EVRSFLTGPDGENIERVVFCSFEMKDVNAYTETLPKYFPPTKDDLPDSETSRDASSEEEK 225 Query: 922 GKI*PRSHARDLDDVSRTIPPVL 854 G+ S A L D T P +L Sbjct: 226 GQTTSESLAASLPDAPTTEPKLL 248 >KZL69777.1 macro domain-containing protein [Colletotrichum tofieldiae] Length = 249 Score = 58.5 bits (140), Expect = 3e-06 Identities = 29/78 (37%), Positives = 43/78 (55%) Frame = -1 Query: 1075 VKKFLQQPDGDKIDKVIFCNFMDKDVDAYAEALPYIFPATEEDRKNKDPNEGKI*PRSHA 896 V+ FL DG K++KV+FC F KDV AY E LP FP T++ K+ EG + A Sbjct: 172 VRDFLDGQDGKKLEKVVFCTFEMKDVKAYNETLPIFFPPTDQPAPTKETKEGP--SKEQA 229 Query: 895 RDLDDVSRTIPPVLRSRP 842 + ++ +P V ++ P Sbjct: 230 EEARAIAAELPSVPKADP 247 >KXH64276.1 macro domain-containing protein [Colletotrichum salicis] Length = 249 Score = 58.5 bits (140), Expect = 3e-06 Identities = 28/78 (35%), Positives = 43/78 (55%) Frame = -1 Query: 1075 VKKFLQQPDGDKIDKVIFCNFMDKDVDAYAEALPYIFPATEEDRKNKDPNEGKI*PRSHA 896 V++FL DGDK+DK++FC F KDV AY E LP FP ++ +K +G + Sbjct: 172 VREFLDGEDGDKLDKIVFCTFEMKDVRAYNETLPVFFPPEDQPATDKKTEDGP--SKKET 229 Query: 895 RDLDDVSRTIPPVLRSRP 842 + ++ +P V +S P Sbjct: 230 EEAKAIAAELPSVPKSDP 247 >XP_007751817.1 hypothetical protein A1O5_13059 [Cladophialophora psammophila CBS 110553] EXJ53703.1 hypothetical protein A1O5_13059 [Cladophialophora psammophila CBS 110553] Length = 342 Score = 59.3 bits (142), Expect = 3e-06 Identities = 23/44 (52%), Positives = 34/44 (77%) Frame = -1 Query: 1078 EVKKFLQQPDGDKIDKVIFCNFMDKDVDAYAEALPYIFPATEED 947 E+ F+++P G ++DK+IFCNF D DVDAY+ LP+ FP T++D Sbjct: 177 EICAFVKEPKGVQLDKIIFCNFTDSDVDAYSRYLPFAFPPTQDD 220 >XP_018070835.1 A1pp-domain-containing protein [Phialocephala scopiformis] KUJ16480.1 A1pp-domain-containing protein [Phialocephala scopiformis] Length = 296 Score = 58.9 bits (141), Expect = 3e-06 Identities = 25/47 (53%), Positives = 35/47 (74%) Frame = -1 Query: 1075 VKKFLQQPDGDKIDKVIFCNFMDKDVDAYAEALPYIFPATEEDRKNK 935 VK FL+ DGDK++KV+FC F+ KDVDAY LP FP+TE + +++ Sbjct: 176 VKDFLEGEDGDKLEKVVFCTFVQKDVDAYNHWLPRFFPSTEPEAEDE 222 >KFY59288.1 hypothetical protein V496_05738 [Pseudogymnoascus sp. VKM F-4515 (FW-2607)] KFY85463.1 hypothetical protein V498_07717 [Pseudogymnoascus sp. VKM F-4517 (FW-2822)] Length = 316 Score = 58.9 bits (141), Expect = 4e-06 Identities = 27/48 (56%), Positives = 34/48 (70%) Frame = -1 Query: 1075 VKKFLQQPDGDKIDKVIFCNFMDKDVDAYAEALPYIFPATEEDRKNKD 932 V+ FL P GDKID+VIFC F KDV+AY + +P+ FP TE+D K D Sbjct: 174 VRGFLGSPAGDKIDRVIFCTFEMKDVNAYNDWIPWAFPPTEQDLKGGD 221 >XP_008098030.1 macro domain-containing protein [Colletotrichum graminicola M1.001] EFQ34010.1 macro domain-containing protein [Colletotrichum graminicola M1.001] Length = 249 Score = 58.2 bits (139), Expect = 4e-06 Identities = 30/78 (38%), Positives = 43/78 (55%) Frame = -1 Query: 1075 VKKFLQQPDGDKIDKVIFCNFMDKDVDAYAEALPYIFPATEEDRKNKDPNEGKI*PRSHA 896 V++FL DG K+DKV+FC F KDV AY E LP FP T++ K ++G A Sbjct: 172 VREFLDGEDGKKLDKVVFCTFEMKDVAAYDETLPIFFPPTDQPASPKKTDDGP--SEEQA 229 Query: 895 RDLDDVSRTIPPVLRSRP 842 + V+ +P V ++ P Sbjct: 230 EEAKAVAAELPSVPKADP 247