BLASTX nr result
ID: Magnolia22_contig00013443
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Magnolia22_contig00013443 (403 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value EYU28687.1 hypothetical protein MIMGU_mgv1a007067mg [Erythranthe... 64 2e-09 XP_012847512.1 PREDICTED: pentatricopeptide repeat-containing pr... 64 2e-09 XP_012847511.1 PREDICTED: pentatricopeptide repeat-containing pr... 64 2e-09 XP_018836993.1 PREDICTED: pentatricopeptide repeat-containing pr... 64 2e-09 XP_003614059.1 PPR containing plant-like protein [Medicago trunc... 62 1e-08 XP_015575272.1 PREDICTED: pentatricopeptide repeat-containing pr... 61 2e-08 XP_017408701.1 PREDICTED: pentatricopeptide repeat-containing pr... 60 6e-08 XP_011086416.1 PREDICTED: pentatricopeptide repeat-containing pr... 60 8e-08 XP_007153862.1 hypothetical protein PHAVU_003G071000g [Phaseolus... 60 8e-08 KYP77915.1 hypothetical protein KK1_049822, partial [Cajanus cajan] 57 9e-08 APR64199.1 hypothetical protein [Populus tomentosa] 59 1e-07 XP_014509604.1 PREDICTED: pentatricopeptide repeat-containing pr... 59 1e-07 XP_016191000.1 PREDICTED: pentatricopeptide repeat-containing pr... 59 2e-07 XP_015956875.1 PREDICTED: pentatricopeptide repeat-containing pr... 59 2e-07 XP_002325053.2 hypothetical protein POPTR_0018s10010g [Populus t... 59 2e-07 OIW20416.1 hypothetical protein TanjilG_11107 [Lupinus angustifo... 58 2e-07 XP_019431023.1 PREDICTED: pentatricopeptide repeat-containing pr... 58 3e-07 XP_009782695.1 PREDICTED: pentatricopeptide repeat-containing pr... 58 3e-07 XP_015064691.1 PREDICTED: pentatricopeptide repeat-containing pr... 58 4e-07 KZV18706.1 pentatricopeptide repeat-containing protein mitochond... 58 4e-07 >EYU28687.1 hypothetical protein MIMGU_mgv1a007067mg [Erythranthe guttata] Length = 421 Score = 64.3 bits (155), Expect = 2e-09 Identities = 26/46 (56%), Positives = 37/46 (80%) Frame = -3 Query: 401 CSLIEVNGTVHEFFAGDISHPQSKEICMLLDEMEQQLESSNHLQEF 264 CS +E+NGTVHEFFAGD +HPQ+KEI LD +E++L+ ++Q+F Sbjct: 288 CSSVEINGTVHEFFAGDSTHPQAKEIYQFLDVIEERLKGEGYIQDF 333 >XP_012847512.1 PREDICTED: pentatricopeptide repeat-containing protein At1g59720, mitochondrial isoform X2 [Erythranthe guttata] Length = 593 Score = 64.3 bits (155), Expect = 2e-09 Identities = 26/46 (56%), Positives = 37/46 (80%) Frame = -3 Query: 401 CSLIEVNGTVHEFFAGDISHPQSKEICMLLDEMEQQLESSNHLQEF 264 CS +E+NGTVHEFFAGD +HPQ+KEI LD +E++L+ ++Q+F Sbjct: 478 CSSVEINGTVHEFFAGDSTHPQAKEIYQFLDVIEERLKGEGYIQDF 523 >XP_012847511.1 PREDICTED: pentatricopeptide repeat-containing protein At1g59720, mitochondrial isoform X1 [Erythranthe guttata] Length = 611 Score = 64.3 bits (155), Expect = 2e-09 Identities = 26/46 (56%), Positives = 37/46 (80%) Frame = -3 Query: 401 CSLIEVNGTVHEFFAGDISHPQSKEICMLLDEMEQQLESSNHLQEF 264 CS +E+NGTVHEFFAGD +HPQ+KEI LD +E++L+ ++Q+F Sbjct: 478 CSSVEINGTVHEFFAGDSTHPQAKEIYQFLDVIEERLKGEGYIQDF 523 >XP_018836993.1 PREDICTED: pentatricopeptide repeat-containing protein At1g59720, chloroplastic/mitochondrial-like [Juglans regia] XP_018808773.1 PREDICTED: pentatricopeptide repeat-containing protein At1g59720, chloroplastic/mitochondrial-like [Juglans regia] Length = 616 Score = 64.3 bits (155), Expect = 2e-09 Identities = 28/46 (60%), Positives = 37/46 (80%) Frame = -3 Query: 401 CSLIEVNGTVHEFFAGDISHPQSKEICMLLDEMEQQLESSNHLQEF 264 CS IE++GT HEFFAGD SHPQ+KEI +LD +E++LES H+ +F Sbjct: 483 CSSIEIDGTSHEFFAGDTSHPQTKEIYQVLDVIEERLESVGHVTDF 528 >XP_003614059.1 PPR containing plant-like protein [Medicago truncatula] AES97017.1 PPR containing plant-like protein [Medicago truncatula] Length = 565 Score = 62.0 bits (149), Expect = 1e-08 Identities = 25/46 (54%), Positives = 37/46 (80%) Frame = -3 Query: 401 CSLIEVNGTVHEFFAGDISHPQSKEICMLLDEMEQQLESSNHLQEF 264 CSLIE+NG HEFFAGD +HPQSK+I ++E++++LES +L ++ Sbjct: 432 CSLIEINGAAHEFFAGDTNHPQSKDIYKFMNEIQEKLESVGYLPDY 477 >XP_015575272.1 PREDICTED: pentatricopeptide repeat-containing protein At1g59720, chloroplastic/mitochondrial [Ricinus communis] Length = 610 Score = 61.2 bits (147), Expect = 2e-08 Identities = 28/46 (60%), Positives = 35/46 (76%) Frame = -3 Query: 401 CSLIEVNGTVHEFFAGDISHPQSKEICMLLDEMEQQLESSNHLQEF 264 CSLIEV+G HEFFAGD SHPQ+KEI LD +EQ+LES + ++ Sbjct: 477 CSLIEVDGVSHEFFAGDTSHPQTKEIYQFLDVIEQRLESVGYSPDY 522 >XP_017408701.1 PREDICTED: pentatricopeptide repeat-containing protein At1g59720, chloroplastic/mitochondrial [Vigna angularis] KOM28200.1 hypothetical protein LR48_Vigan511s002300 [Vigna angularis] BAT74589.1 hypothetical protein VIGAN_01229200 [Vigna angularis var. angularis] Length = 611 Score = 60.1 bits (144), Expect = 6e-08 Identities = 25/50 (50%), Positives = 38/50 (76%) Frame = -3 Query: 401 CSLIEVNGTVHEFFAGDISHPQSKEICMLLDEMEQQLESSNHLQEFDVCT 252 CSLIE++GTVHEFFAGD +HPQS+ I + E++++L+S +L ++ T Sbjct: 478 CSLIEIDGTVHEFFAGDTTHPQSENIYKFVSEIDEKLQSIGYLPDYSGAT 527 >XP_011086416.1 PREDICTED: pentatricopeptide repeat-containing protein At1g59720, mitochondrial [Sesamum indicum] Length = 607 Score = 59.7 bits (143), Expect = 8e-08 Identities = 25/46 (54%), Positives = 36/46 (78%) Frame = -3 Query: 401 CSLIEVNGTVHEFFAGDISHPQSKEICMLLDEMEQQLESSNHLQEF 264 CS IE+NG VHEFFAGD +HPQ+KEI LD +E++L+ + ++ +F Sbjct: 474 CSSIEINGIVHEFFAGDTTHPQTKEIYQFLDVIEERLKLAGYVPDF 519 >XP_007153862.1 hypothetical protein PHAVU_003G071000g [Phaseolus vulgaris] ESW25856.1 hypothetical protein PHAVU_003G071000g [Phaseolus vulgaris] Length = 610 Score = 59.7 bits (143), Expect = 8e-08 Identities = 25/50 (50%), Positives = 38/50 (76%) Frame = -3 Query: 401 CSLIEVNGTVHEFFAGDISHPQSKEICMLLDEMEQQLESSNHLQEFDVCT 252 CSLIE++G VHEFFAGD +HPQS+ + ++E+E++L+S +L +F T Sbjct: 477 CSLIEIDGGVHEFFAGDTTHPQSENVYKFVNEIEEKLQSIGYLPDFSGAT 526 >KYP77915.1 hypothetical protein KK1_049822, partial [Cajanus cajan] Length = 147 Score = 57.4 bits (137), Expect = 9e-08 Identities = 24/46 (52%), Positives = 35/46 (76%) Frame = -3 Query: 401 CSLIEVNGTVHEFFAGDISHPQSKEICMLLDEMEQQLESSNHLQEF 264 CSLIE++G VHEFFAGD +HPQS+ I + E+E ++ES +L ++ Sbjct: 14 CSLIEIDGVVHEFFAGDTTHPQSENIYKFVSEIEGKMESIGYLPDY 59 >APR64199.1 hypothetical protein [Populus tomentosa] Length = 607 Score = 59.3 bits (142), Expect = 1e-07 Identities = 25/46 (54%), Positives = 37/46 (80%) Frame = -3 Query: 401 CSLIEVNGTVHEFFAGDISHPQSKEICMLLDEMEQQLESSNHLQEF 264 CSLIEV+G HEFFAGD SHPQ+KEI +L+ +E++L+S+ + ++ Sbjct: 474 CSLIEVDGVTHEFFAGDTSHPQTKEIYQVLNVIEERLDSTGYKPDY 519 >XP_014509604.1 PREDICTED: pentatricopeptide repeat-containing protein At1g59720, chloroplastic/mitochondrial [Vigna radiata var. radiata] Length = 611 Score = 59.3 bits (142), Expect = 1e-07 Identities = 25/50 (50%), Positives = 37/50 (74%) Frame = -3 Query: 401 CSLIEVNGTVHEFFAGDISHPQSKEICMLLDEMEQQLESSNHLQEFDVCT 252 CSLIE++GTVHEFFAGD +HPQS+ I + E++ +L+S +L ++ T Sbjct: 478 CSLIEIDGTVHEFFAGDTTHPQSENIYKFVSEIDDKLQSIGYLPDYSGAT 527 >XP_016191000.1 PREDICTED: pentatricopeptide repeat-containing protein At1g59720, chloroplastic/mitochondrial [Arachis ipaensis] Length = 615 Score = 58.9 bits (141), Expect = 2e-07 Identities = 22/46 (47%), Positives = 37/46 (80%) Frame = -3 Query: 401 CSLIEVNGTVHEFFAGDISHPQSKEICMLLDEMEQQLESSNHLQEF 264 CSL+E++G HEFFAGD SHPQS++I + E+E++LE++ ++ ++ Sbjct: 482 CSLVEIDGVTHEFFAGDTSHPQSEDIYKFMSEIEEKLEATGYVPDY 527 >XP_015956875.1 PREDICTED: pentatricopeptide repeat-containing protein At1g59720, chloroplastic/mitochondrial [Arachis duranensis] Length = 615 Score = 58.9 bits (141), Expect = 2e-07 Identities = 22/46 (47%), Positives = 37/46 (80%) Frame = -3 Query: 401 CSLIEVNGTVHEFFAGDISHPQSKEICMLLDEMEQQLESSNHLQEF 264 CSL+E++G HEFFAGD SHPQS++I + E+E++LE++ ++ ++ Sbjct: 482 CSLVEIDGVTHEFFAGDTSHPQSEDIYKFMSEIEEKLEATGYVPDY 527 >XP_002325053.2 hypothetical protein POPTR_0018s10010g [Populus trichocarpa] EEF03618.2 hypothetical protein POPTR_0018s10010g [Populus trichocarpa] Length = 595 Score = 58.5 bits (140), Expect = 2e-07 Identities = 24/46 (52%), Positives = 37/46 (80%) Frame = -3 Query: 401 CSLIEVNGTVHEFFAGDISHPQSKEICMLLDEMEQQLESSNHLQEF 264 CSLIEV+G HEFFAGD SHPQ+KEI +L+ +E++++S+ + ++ Sbjct: 462 CSLIEVDGVTHEFFAGDTSHPQTKEIYQVLNVVEERIDSTGYKPDY 507 >OIW20416.1 hypothetical protein TanjilG_11107 [Lupinus angustifolius] Length = 356 Score = 58.2 bits (139), Expect = 2e-07 Identities = 24/46 (52%), Positives = 35/46 (76%) Frame = -3 Query: 401 CSLIEVNGTVHEFFAGDISHPQSKEICMLLDEMEQQLESSNHLQEF 264 CSLIE+NG HEFFAGD +HPQ + I ++E+E++LES ++ +F Sbjct: 290 CSLIEINGATHEFFAGDTTHPQRESIYNFMNEVEKKLESIGYVPDF 335 >XP_019431023.1 PREDICTED: pentatricopeptide repeat-containing protein At1g59720, chloroplastic/mitochondrial [Lupinus angustifolius] Length = 619 Score = 58.2 bits (139), Expect = 3e-07 Identities = 24/46 (52%), Positives = 35/46 (76%) Frame = -3 Query: 401 CSLIEVNGTVHEFFAGDISHPQSKEICMLLDEMEQQLESSNHLQEF 264 CSLIE+NG HEFFAGD +HPQ + I ++E+E++LES ++ +F Sbjct: 486 CSLIEINGATHEFFAGDTTHPQRESIYNFMNEVEKKLESIGYVPDF 531 >XP_009782695.1 PREDICTED: pentatricopeptide repeat-containing protein At4g37380, chloroplastic [Nicotiana sylvestris] XP_016510091.1 PREDICTED: pentatricopeptide repeat-containing protein ELI1, chloroplastic-like [Nicotiana tabacum] Length = 627 Score = 58.2 bits (139), Expect = 3e-07 Identities = 26/48 (54%), Positives = 35/48 (72%) Frame = -3 Query: 401 CSLIEVNGTVHEFFAGDISHPQSKEICMLLDEMEQQLESSNHLQEFDV 258 CS IEVN VHEF AGD+ HP+SKEI +L+EM + LE+ ++ + DV Sbjct: 495 CSSIEVNNKVHEFLAGDMKHPKSKEIYTMLEEMNKWLEAHGYMPQTDV 542 >XP_015064691.1 PREDICTED: pentatricopeptide repeat-containing protein ELI1, chloroplastic isoform X2 [Solanum pennellii] Length = 596 Score = 57.8 bits (138), Expect = 4e-07 Identities = 25/48 (52%), Positives = 36/48 (75%) Frame = -3 Query: 401 CSLIEVNGTVHEFFAGDISHPQSKEICMLLDEMEQQLESSNHLQEFDV 258 CS IEVN VHEF AGD+ HP+SKEI ++L+E+ + LE+ +L + D+ Sbjct: 464 CSSIEVNNKVHEFLAGDMKHPKSKEIYIMLEEVNKLLEAHGYLPQTDI 511 >KZV18706.1 pentatricopeptide repeat-containing protein mitochondrial [Dorcoceras hygrometricum] Length = 605 Score = 57.8 bits (138), Expect = 4e-07 Identities = 23/45 (51%), Positives = 35/45 (77%) Frame = -3 Query: 401 CSLIEVNGTVHEFFAGDISHPQSKEICMLLDEMEQQLESSNHLQE 267 C+ IE++GTVHEFFAGD++HP+ KEI LD + ++LES ++ + Sbjct: 471 CTSIEIDGTVHEFFAGDVTHPRKKEIYQFLDVVNEKLESEGYVPD 515