BLASTX nr result
ID: Magnolia22_contig00011149
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Magnolia22_contig00011149 (489 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AEB37791.1 calmodulin-binding cyclic nucleotide gated channel 15... 280 2e-94 AEB37793.1 calmodulin-binding cyclic nucleotide gated channel 15... 280 2e-94 AEB37810.1 calmodulin-binding cyclic nucleotide gated channel 15... 279 3e-94 AEB37765.1 calmodulin-binding cyclic nucleotide gated channel 15... 279 3e-94 ADO62375.1 putative cyclic nucleotide-gated channel, partial [He... 279 3e-94 ADO62320.1 putative cyclic nucleotide-gated channel, partial [He... 279 3e-94 ADO62336.1 putative cyclic nucleotide-gated channel, partial [He... 279 3e-94 ADO62426.1 putative cyclic nucleotide-gated channel, partial [He... 279 3e-94 ADO62356.1 putative cyclic nucleotide-gated channel, partial [He... 279 3e-94 ADO62392.1 putative cyclic nucleotide-gated channel, partial [He... 279 3e-94 AEB37795.1 calmodulin-binding cyclic nucleotide gated channel 15... 279 3e-94 AEB37770.1 calmodulin-binding cyclic nucleotide gated channel 15... 279 4e-94 ADO62374.1 putative cyclic nucleotide-gated channel, partial [He... 279 4e-94 ADO62354.1 putative cyclic nucleotide-gated channel, partial [He... 279 4e-94 ADO62314.1 putative cyclic nucleotide-gated channel, partial [He... 279 4e-94 AEB37812.1 calmodulin-binding cyclic nucleotide gated channel 15... 279 4e-94 AEB37778.1 calmodulin-binding cyclic nucleotide gated channel 15... 278 6e-94 AEB37779.1 calmodulin-binding cyclic nucleotide gated channel 15... 278 7e-94 AEB37817.1 calmodulin-binding cyclic nucleotide gated channel 15... 278 1e-93 ADO62407.1 putative cyclic nucleotide-gated channel, partial [He... 278 1e-93 >AEB37791.1 calmodulin-binding cyclic nucleotide gated channel 15, partial [Helianthus exilis] Length = 180 Score = 280 bits (715), Expect = 2e-94 Identities = 131/142 (92%), Positives = 139/142 (97%) Frame = +2 Query: 2 QGTCLVREGDPVNEMLFIIRGHLDSYTTNGGRTGFFNSCRIGPGDFCGEELLTWALDPRP 181 QGTCLVREGDPVNEMLFIIRG+LDSYTTNGGRTGFFNSCRIGPGDFCGEELLTWALDPRP Sbjct: 37 QGTCLVREGDPVNEMLFIIRGNLDSYTTNGGRTGFFNSCRIGPGDFCGEELLTWALDPRP 96 Query: 182 SVILPSSTRTVKALSEVEAFALSAEDLKFVASQFRRLHSKQLRHKFRFYSHQWRTWAACF 361 SVILPSSTRTVKA+SEVEAFAL A+DLKFVASQFRRLHSKQLRHKFRFYSHQWRTWAACF Sbjct: 97 SVILPSSTRTVKAISEVEAFALIADDLKFVASQFRRLHSKQLRHKFRFYSHQWRTWAACF 156 Query: 362 IQAAWRRFKRRKDSADLKAREN 427 +QAAWRR+KRRK + +LKARE+ Sbjct: 157 VQAAWRRYKRRKSARELKARES 178 >AEB37793.1 calmodulin-binding cyclic nucleotide gated channel 15, partial [Helianthus exilis] AEB37794.1 calmodulin-binding cyclic nucleotide gated channel 15, partial [Helianthus exilis] Length = 184 Score = 280 bits (715), Expect = 2e-94 Identities = 131/142 (92%), Positives = 139/142 (97%) Frame = +2 Query: 2 QGTCLVREGDPVNEMLFIIRGHLDSYTTNGGRTGFFNSCRIGPGDFCGEELLTWALDPRP 181 QGTCLVREGDPVNEMLFIIRG+LDSYTTNGGRTGFFNSCRIGPGDFCGEELLTWALDPRP Sbjct: 39 QGTCLVREGDPVNEMLFIIRGNLDSYTTNGGRTGFFNSCRIGPGDFCGEELLTWALDPRP 98 Query: 182 SVILPSSTRTVKALSEVEAFALSAEDLKFVASQFRRLHSKQLRHKFRFYSHQWRTWAACF 361 SVILPSSTRTVKA+SEVEAFAL A+DLKFVASQFRRLHSKQLRHKFRFYSHQWRTWAACF Sbjct: 99 SVILPSSTRTVKAISEVEAFALIADDLKFVASQFRRLHSKQLRHKFRFYSHQWRTWAACF 158 Query: 362 IQAAWRRFKRRKDSADLKAREN 427 +QAAWRR+KRRK + +LKARE+ Sbjct: 159 VQAAWRRYKRRKSARELKARES 180 >AEB37810.1 calmodulin-binding cyclic nucleotide gated channel 15, partial [Helianthus tuberosus] Length = 177 Score = 279 bits (714), Expect = 3e-94 Identities = 130/142 (91%), Positives = 139/142 (97%) Frame = +2 Query: 2 QGTCLVREGDPVNEMLFIIRGHLDSYTTNGGRTGFFNSCRIGPGDFCGEELLTWALDPRP 181 QGTCLVREGDPVNEMLFI+RG+LDSYTTNGGRTGFFNSCRIGPGDFCGEELLTWALDPRP Sbjct: 36 QGTCLVREGDPVNEMLFIVRGNLDSYTTNGGRTGFFNSCRIGPGDFCGEELLTWALDPRP 95 Query: 182 SVILPSSTRTVKALSEVEAFALSAEDLKFVASQFRRLHSKQLRHKFRFYSHQWRTWAACF 361 SVILPSSTRTVKA+SEVEAFAL A+DLKFVASQFRRLHSKQLRHKFRFYSHQWRTWAACF Sbjct: 96 SVILPSSTRTVKAISEVEAFALIADDLKFVASQFRRLHSKQLRHKFRFYSHQWRTWAACF 155 Query: 362 IQAAWRRFKRRKDSADLKAREN 427 +QAAWRR+KRRK + +LKARE+ Sbjct: 156 VQAAWRRYKRRKSARELKARES 177 >AEB37765.1 calmodulin-binding cyclic nucleotide gated channel 15, partial [Helianthus petiolaris] AEB37766.1 calmodulin-binding cyclic nucleotide gated channel 15, partial [Helianthus petiolaris] Length = 179 Score = 279 bits (714), Expect = 3e-94 Identities = 130/142 (91%), Positives = 139/142 (97%) Frame = +2 Query: 2 QGTCLVREGDPVNEMLFIIRGHLDSYTTNGGRTGFFNSCRIGPGDFCGEELLTWALDPRP 181 QGTCLVREGDPVNEMLFI+RG+LDSYTTNGGRTGFFNSCRIGPGDFCGEELLTWALDPRP Sbjct: 36 QGTCLVREGDPVNEMLFIVRGNLDSYTTNGGRTGFFNSCRIGPGDFCGEELLTWALDPRP 95 Query: 182 SVILPSSTRTVKALSEVEAFALSAEDLKFVASQFRRLHSKQLRHKFRFYSHQWRTWAACF 361 SVILPSSTRTVKA+SEVEAFAL A+DLKFVASQFRRLHSKQLRHKFRFYSHQWRTWAACF Sbjct: 96 SVILPSSTRTVKAISEVEAFALIADDLKFVASQFRRLHSKQLRHKFRFYSHQWRTWAACF 155 Query: 362 IQAAWRRFKRRKDSADLKAREN 427 +QAAWRR+KRRK + +LKARE+ Sbjct: 156 VQAAWRRYKRRKSARELKARES 177 >ADO62375.1 putative cyclic nucleotide-gated channel, partial [Helianthus annuus] ADO62430.1 putative cyclic nucleotide-gated channel, partial [Helianthus annuus] ADO62431.1 putative cyclic nucleotide-gated channel, partial [Helianthus annuus] Length = 179 Score = 279 bits (714), Expect = 3e-94 Identities = 130/142 (91%), Positives = 139/142 (97%) Frame = +2 Query: 2 QGTCLVREGDPVNEMLFIIRGHLDSYTTNGGRTGFFNSCRIGPGDFCGEELLTWALDPRP 181 QGTCLVREGDPVNEMLFI+RG+LDSYTTNGGRTGFFNSCRIGPGDFCGEELLTWALDPRP Sbjct: 37 QGTCLVREGDPVNEMLFIVRGNLDSYTTNGGRTGFFNSCRIGPGDFCGEELLTWALDPRP 96 Query: 182 SVILPSSTRTVKALSEVEAFALSAEDLKFVASQFRRLHSKQLRHKFRFYSHQWRTWAACF 361 SVILPSSTRTVKA+SEVEAFAL A+DLKFVASQFRRLHSKQLRHKFRFYSHQWRTWAACF Sbjct: 97 SVILPSSTRTVKAISEVEAFALIADDLKFVASQFRRLHSKQLRHKFRFYSHQWRTWAACF 156 Query: 362 IQAAWRRFKRRKDSADLKAREN 427 +QAAWRR+KRRK + +LKARE+ Sbjct: 157 VQAAWRRYKRRKSARELKARES 178 >ADO62320.1 putative cyclic nucleotide-gated channel, partial [Helianthus argophyllus] ADO62321.1 putative cyclic nucleotide-gated channel, partial [Helianthus argophyllus] Length = 179 Score = 279 bits (714), Expect = 3e-94 Identities = 130/142 (91%), Positives = 139/142 (97%) Frame = +2 Query: 2 QGTCLVREGDPVNEMLFIIRGHLDSYTTNGGRTGFFNSCRIGPGDFCGEELLTWALDPRP 181 QGTCLVREGDPVNEMLFI+RG+LDSYTTNGGRTGFFNSCRIGPGDFCGEELLTWALDPRP Sbjct: 37 QGTCLVREGDPVNEMLFIVRGNLDSYTTNGGRTGFFNSCRIGPGDFCGEELLTWALDPRP 96 Query: 182 SVILPSSTRTVKALSEVEAFALSAEDLKFVASQFRRLHSKQLRHKFRFYSHQWRTWAACF 361 SVILPSSTRTVKA+SEVEAFAL A+DLKFVASQFRRLHSKQLRHKFRFYSHQWRTWAACF Sbjct: 97 SVILPSSTRTVKAISEVEAFALIADDLKFVASQFRRLHSKQLRHKFRFYSHQWRTWAACF 156 Query: 362 IQAAWRRFKRRKDSADLKAREN 427 +QAAWRR+KRRK + +LKARE+ Sbjct: 157 VQAAWRRYKRRKSARELKARES 178 >ADO62336.1 putative cyclic nucleotide-gated channel, partial [Helianthus annuus] ADO62337.1 putative cyclic nucleotide-gated channel, partial [Helianthus annuus] ADO62358.1 putative cyclic nucleotide-gated channel, partial [Helianthus annuus] ADO62359.1 putative cyclic nucleotide-gated channel, partial [Helianthus annuus] ADO62366.1 putative cyclic nucleotide-gated channel, partial [Helianthus annuus] ADO62367.1 putative cyclic nucleotide-gated channel, partial [Helianthus annuus] ADO62390.1 putative cyclic nucleotide-gated channel, partial [Helianthus annuus] ADO62391.1 putative cyclic nucleotide-gated channel, partial [Helianthus annuus] ADO62400.1 putative cyclic nucleotide-gated channel, partial [Helianthus annuus] ADO62401.1 putative cyclic nucleotide-gated channel, partial [Helianthus annuus] ADO62402.1 putative cyclic nucleotide-gated channel, partial [Helianthus annuus] ADO62403.1 putative cyclic nucleotide-gated channel, partial [Helianthus annuus] ADO62404.1 putative cyclic nucleotide-gated channel, partial [Helianthus annuus] ADO62405.1 putative cyclic nucleotide-gated channel, partial [Helianthus annuus] ADO62412.1 putative cyclic nucleotide-gated channel, partial [Helianthus annuus] ADO62413.1 putative cyclic nucleotide-gated channel, partial [Helianthus annuus] ADO62422.1 putative cyclic nucleotide-gated channel, partial [Helianthus annuus] ADO62423.1 putative cyclic nucleotide-gated channel, partial [Helianthus annuus] ADO62432.1 putative cyclic nucleotide-gated channel, partial [Helianthus annuus] ADO62433.1 putative cyclic nucleotide-gated channel, partial [Helianthus annuus] ADO62434.1 putative cyclic nucleotide-gated channel, partial [Helianthus annuus] ADO62435.1 putative cyclic nucleotide-gated channel, partial [Helianthus annuus] ADO62436.1 putative cyclic nucleotide-gated channel, partial [Helianthus annuus] ADO62437.1 putative cyclic nucleotide-gated channel, partial [Helianthus annuus] ADO62440.1 putative cyclic nucleotide-gated channel, partial [Helianthus annuus] ADO62441.1 putative cyclic nucleotide-gated channel, partial [Helianthus annuus] AEB37767.1 calmodulin-binding cyclic nucleotide gated channel 15, partial [Helianthus petiolaris] AEB37768.1 calmodulin-binding cyclic nucleotide gated channel 15, partial [Helianthus petiolaris] AEB37775.1 calmodulin-binding cyclic nucleotide gated channel 15, partial [Helianthus petiolaris] AEB37776.1 calmodulin-binding cyclic nucleotide gated channel 15, partial [Helianthus petiolaris] AEB37777.1 calmodulin-binding cyclic nucleotide gated channel 15, partial [Helianthus paradoxus] AEB37792.1 calmodulin-binding cyclic nucleotide gated channel 15, partial [Helianthus exilis] AEB37799.1 calmodulin-binding cyclic nucleotide gated channel 15, partial [Helianthus exilis] AEB37800.1 calmodulin-binding cyclic nucleotide gated channel 15, partial [Helianthus exilis] AEB37816.1 calmodulin-binding cyclic nucleotide gated channel 15, partial [Helianthus tuberosus] Length = 180 Score = 279 bits (714), Expect = 3e-94 Identities = 130/142 (91%), Positives = 139/142 (97%) Frame = +2 Query: 2 QGTCLVREGDPVNEMLFIIRGHLDSYTTNGGRTGFFNSCRIGPGDFCGEELLTWALDPRP 181 QGTCLVREGDPVNEMLFI+RG+LDSYTTNGGRTGFFNSCRIGPGDFCGEELLTWALDPRP Sbjct: 37 QGTCLVREGDPVNEMLFIVRGNLDSYTTNGGRTGFFNSCRIGPGDFCGEELLTWALDPRP 96 Query: 182 SVILPSSTRTVKALSEVEAFALSAEDLKFVASQFRRLHSKQLRHKFRFYSHQWRTWAACF 361 SVILPSSTRTVKA+SEVEAFAL A+DLKFVASQFRRLHSKQLRHKFRFYSHQWRTWAACF Sbjct: 97 SVILPSSTRTVKAISEVEAFALIADDLKFVASQFRRLHSKQLRHKFRFYSHQWRTWAACF 156 Query: 362 IQAAWRRFKRRKDSADLKAREN 427 +QAAWRR+KRRK + +LKARE+ Sbjct: 157 VQAAWRRYKRRKSARELKARES 178 >ADO62426.1 putative cyclic nucleotide-gated channel, partial [Helianthus annuus] ADO62427.1 putative cyclic nucleotide-gated channel, partial [Helianthus annuus] AEB37796.1 calmodulin-binding cyclic nucleotide gated channel 15, partial [Helianthus exilis] AEB37818.1 calmodulin-binding cyclic nucleotide gated channel 15, partial [Helianthus tuberosus] Length = 181 Score = 279 bits (714), Expect = 3e-94 Identities = 130/142 (91%), Positives = 139/142 (97%) Frame = +2 Query: 2 QGTCLVREGDPVNEMLFIIRGHLDSYTTNGGRTGFFNSCRIGPGDFCGEELLTWALDPRP 181 QGTCLVREGDPVNEMLFI+RG+LDSYTTNGGRTGFFNSCRIGPGDFCGEELLTWALDPRP Sbjct: 38 QGTCLVREGDPVNEMLFIVRGNLDSYTTNGGRTGFFNSCRIGPGDFCGEELLTWALDPRP 97 Query: 182 SVILPSSTRTVKALSEVEAFALSAEDLKFVASQFRRLHSKQLRHKFRFYSHQWRTWAACF 361 SVILPSSTRTVKA+SEVEAFAL A+DLKFVASQFRRLHSKQLRHKFRFYSHQWRTWAACF Sbjct: 98 SVILPSSTRTVKAISEVEAFALIADDLKFVASQFRRLHSKQLRHKFRFYSHQWRTWAACF 157 Query: 362 IQAAWRRFKRRKDSADLKAREN 427 +QAAWRR+KRRK + +LKARE+ Sbjct: 158 VQAAWRRYKRRKSARELKARES 179 >ADO62356.1 putative cyclic nucleotide-gated channel, partial [Helianthus annuus] ADO62357.1 putative cyclic nucleotide-gated channel, partial [Helianthus annuus] ADO62362.1 putative cyclic nucleotide-gated channel, partial [Helianthus annuus] ADO62363.1 putative cyclic nucleotide-gated channel, partial [Helianthus annuus] Length = 181 Score = 279 bits (714), Expect = 3e-94 Identities = 130/142 (91%), Positives = 139/142 (97%) Frame = +2 Query: 2 QGTCLVREGDPVNEMLFIIRGHLDSYTTNGGRTGFFNSCRIGPGDFCGEELLTWALDPRP 181 QGTCLVREGDPVNEMLFI+RG+LDSYTTNGGRTGFFNSCRIGPGDFCGEELLTWALDPRP Sbjct: 39 QGTCLVREGDPVNEMLFIVRGNLDSYTTNGGRTGFFNSCRIGPGDFCGEELLTWALDPRP 98 Query: 182 SVILPSSTRTVKALSEVEAFALSAEDLKFVASQFRRLHSKQLRHKFRFYSHQWRTWAACF 361 SVILPSSTRTVKA+SEVEAFAL A+DLKFVASQFRRLHSKQLRHKFRFYSHQWRTWAACF Sbjct: 99 SVILPSSTRTVKAISEVEAFALIADDLKFVASQFRRLHSKQLRHKFRFYSHQWRTWAACF 158 Query: 362 IQAAWRRFKRRKDSADLKAREN 427 +QAAWRR+KRRK + +LKARE+ Sbjct: 159 VQAAWRRYKRRKSARELKARES 180 >ADO62392.1 putative cyclic nucleotide-gated channel, partial [Helianthus annuus] ADO62393.1 putative cyclic nucleotide-gated channel, partial [Helianthus annuus] AEB37802.1 calmodulin-binding cyclic nucleotide gated channel 15, partial [Helianthus tuberosus] Length = 182 Score = 279 bits (714), Expect = 3e-94 Identities = 130/142 (91%), Positives = 139/142 (97%) Frame = +2 Query: 2 QGTCLVREGDPVNEMLFIIRGHLDSYTTNGGRTGFFNSCRIGPGDFCGEELLTWALDPRP 181 QGTCLVREGDPVNEMLFI+RG+LDSYTTNGGRTGFFNSCRIGPGDFCGEELLTWALDPRP Sbjct: 39 QGTCLVREGDPVNEMLFIVRGNLDSYTTNGGRTGFFNSCRIGPGDFCGEELLTWALDPRP 98 Query: 182 SVILPSSTRTVKALSEVEAFALSAEDLKFVASQFRRLHSKQLRHKFRFYSHQWRTWAACF 361 SVILPSSTRTVKA+SEVEAFAL A+DLKFVASQFRRLHSKQLRHKFRFYSHQWRTWAACF Sbjct: 99 SVILPSSTRTVKAISEVEAFALIADDLKFVASQFRRLHSKQLRHKFRFYSHQWRTWAACF 158 Query: 362 IQAAWRRFKRRKDSADLKAREN 427 +QAAWRR+KRRK + +LKARE+ Sbjct: 159 VQAAWRRYKRRKSARELKARES 180 >AEB37795.1 calmodulin-binding cyclic nucleotide gated channel 15, partial [Helianthus exilis] Length = 183 Score = 279 bits (714), Expect = 3e-94 Identities = 130/142 (91%), Positives = 139/142 (97%) Frame = +2 Query: 2 QGTCLVREGDPVNEMLFIIRGHLDSYTTNGGRTGFFNSCRIGPGDFCGEELLTWALDPRP 181 QGTCLVREGDPVNEMLFI+RG+LDSYTTNGGRTGFFNSCRIGPGDFCGEELLTWALDPRP Sbjct: 38 QGTCLVREGDPVNEMLFIVRGNLDSYTTNGGRTGFFNSCRIGPGDFCGEELLTWALDPRP 97 Query: 182 SVILPSSTRTVKALSEVEAFALSAEDLKFVASQFRRLHSKQLRHKFRFYSHQWRTWAACF 361 SVILPSSTRTVKA+SEVEAFAL A+DLKFVASQFRRLHSKQLRHKFRFYSHQWRTWAACF Sbjct: 98 SVILPSSTRTVKAISEVEAFALIADDLKFVASQFRRLHSKQLRHKFRFYSHQWRTWAACF 157 Query: 362 IQAAWRRFKRRKDSADLKAREN 427 +QAAWRR+KRRK + +LKARE+ Sbjct: 158 VQAAWRRYKRRKSARELKARES 179 >AEB37770.1 calmodulin-binding cyclic nucleotide gated channel 15, partial [Helianthus petiolaris] Length = 184 Score = 279 bits (714), Expect = 4e-94 Identities = 130/142 (91%), Positives = 139/142 (97%) Frame = +2 Query: 2 QGTCLVREGDPVNEMLFIIRGHLDSYTTNGGRTGFFNSCRIGPGDFCGEELLTWALDPRP 181 QGTCLVREGDPVNEMLFI+RG+LDSYTTNGGRTGFFNSCRIGPGDFCGEELLTWALDPRP Sbjct: 39 QGTCLVREGDPVNEMLFIVRGNLDSYTTNGGRTGFFNSCRIGPGDFCGEELLTWALDPRP 98 Query: 182 SVILPSSTRTVKALSEVEAFALSAEDLKFVASQFRRLHSKQLRHKFRFYSHQWRTWAACF 361 SVILPSSTRTVKA+SEVEAFAL A+DLKFVASQFRRLHSKQLRHKFRFYSHQWRTWAACF Sbjct: 99 SVILPSSTRTVKAISEVEAFALIADDLKFVASQFRRLHSKQLRHKFRFYSHQWRTWAACF 158 Query: 362 IQAAWRRFKRRKDSADLKAREN 427 +QAAWRR+KRRK + +LKARE+ Sbjct: 159 VQAAWRRYKRRKSARELKARES 180 >ADO62374.1 putative cyclic nucleotide-gated channel, partial [Helianthus annuus] Length = 184 Score = 279 bits (714), Expect = 4e-94 Identities = 130/142 (91%), Positives = 139/142 (97%) Frame = +2 Query: 2 QGTCLVREGDPVNEMLFIIRGHLDSYTTNGGRTGFFNSCRIGPGDFCGEELLTWALDPRP 181 QGTCLVREGDPVNEMLFI+RG+LDSYTTNGGRTGFFNSCRIGPGDFCGEELLTWALDPRP Sbjct: 39 QGTCLVREGDPVNEMLFIVRGNLDSYTTNGGRTGFFNSCRIGPGDFCGEELLTWALDPRP 98 Query: 182 SVILPSSTRTVKALSEVEAFALSAEDLKFVASQFRRLHSKQLRHKFRFYSHQWRTWAACF 361 SVILPSSTRTVKA+SEVEAFAL A+DLKFVASQFRRLHSKQLRHKFRFYSHQWRTWAACF Sbjct: 99 SVILPSSTRTVKAISEVEAFALIADDLKFVASQFRRLHSKQLRHKFRFYSHQWRTWAACF 158 Query: 362 IQAAWRRFKRRKDSADLKAREN 427 +QAAWRR+KRRK + +LKARE+ Sbjct: 159 VQAAWRRYKRRKSARELKARES 180 >ADO62354.1 putative cyclic nucleotide-gated channel, partial [Helianthus annuus] ADO62355.1 putative cyclic nucleotide-gated channel, partial [Helianthus annuus] Length = 184 Score = 279 bits (714), Expect = 4e-94 Identities = 130/142 (91%), Positives = 139/142 (97%) Frame = +2 Query: 2 QGTCLVREGDPVNEMLFIIRGHLDSYTTNGGRTGFFNSCRIGPGDFCGEELLTWALDPRP 181 QGTCLVREGDPVNEMLFI+RG+LDSYTTNGGRTGFFNSCRIGPGDFCGEELLTWALDPRP Sbjct: 39 QGTCLVREGDPVNEMLFIVRGNLDSYTTNGGRTGFFNSCRIGPGDFCGEELLTWALDPRP 98 Query: 182 SVILPSSTRTVKALSEVEAFALSAEDLKFVASQFRRLHSKQLRHKFRFYSHQWRTWAACF 361 SVILPSSTRTVKA+SEVEAFAL A+DLKFVASQFRRLHSKQLRHKFRFYSHQWRTWAACF Sbjct: 99 SVILPSSTRTVKAISEVEAFALIADDLKFVASQFRRLHSKQLRHKFRFYSHQWRTWAACF 158 Query: 362 IQAAWRRFKRRKDSADLKAREN 427 +QAAWRR+KRRK + +LKARE+ Sbjct: 159 VQAAWRRYKRRKSARELKARES 180 >ADO62314.1 putative cyclic nucleotide-gated channel, partial [Helianthus argophyllus] ADO62315.1 putative cyclic nucleotide-gated channel, partial [Helianthus argophyllus] ADO62316.1 putative cyclic nucleotide-gated channel, partial [Helianthus argophyllus] ADO62317.1 putative cyclic nucleotide-gated channel, partial [Helianthus argophyllus] ADO62318.1 putative cyclic nucleotide-gated channel, partial [Helianthus argophyllus] ADO62319.1 putative cyclic nucleotide-gated channel, partial [Helianthus argophyllus] ADO62322.1 putative cyclic nucleotide-gated channel, partial [Helianthus argophyllus] ADO62323.1 putative cyclic nucleotide-gated channel, partial [Helianthus argophyllus] ADO62324.1 putative cyclic nucleotide-gated channel, partial [Helianthus argophyllus] ADO62325.1 putative cyclic nucleotide-gated channel, partial [Helianthus argophyllus] ADO62326.1 putative cyclic nucleotide-gated channel, partial [Helianthus annuus] ADO62327.1 putative cyclic nucleotide-gated channel, partial [Helianthus annuus] ADO62328.1 putative cyclic nucleotide-gated channel, partial [Helianthus annuus] ADO62329.1 putative cyclic nucleotide-gated channel, partial [Helianthus annuus] ADO62330.1 putative cyclic nucleotide-gated channel, partial [Helianthus annuus] ADO62331.1 putative cyclic nucleotide-gated channel, partial [Helianthus annuus] ADO62332.1 putative cyclic nucleotide-gated channel, partial [Helianthus annuus] ADO62333.1 putative cyclic nucleotide-gated channel, partial [Helianthus annuus] ADO62334.1 putative cyclic nucleotide-gated channel, partial [Helianthus annuus] ADO62335.1 putative cyclic nucleotide-gated channel, partial [Helianthus annuus] ADO62338.1 putative cyclic nucleotide-gated channel, partial [Helianthus annuus] ADO62339.1 putative cyclic nucleotide-gated channel, partial [Helianthus annuus] ADO62340.1 putative cyclic nucleotide-gated channel, partial [Helianthus annuus] ADO62341.1 putative cyclic nucleotide-gated channel, partial [Helianthus annuus] ADO62342.1 putative cyclic nucleotide-gated channel, partial [Helianthus annuus] ADO62343.1 putative cyclic nucleotide-gated channel, partial [Helianthus annuus] ADO62344.1 putative cyclic nucleotide-gated channel, partial [Helianthus annuus] ADO62345.1 putative cyclic nucleotide-gated channel, partial [Helianthus annuus] ADO62346.1 putative cyclic nucleotide-gated channel, partial [Helianthus annuus] ADO62347.1 putative cyclic nucleotide-gated channel, partial [Helianthus annuus] ADO62348.1 putative cyclic nucleotide-gated channel, partial [Helianthus annuus] ADO62349.1 putative cyclic nucleotide-gated channel, partial [Helianthus annuus] ADO62350.1 putative cyclic nucleotide-gated channel, partial [Helianthus annuus] ADO62351.1 putative cyclic nucleotide-gated channel, partial [Helianthus annuus] ADO62352.1 putative cyclic nucleotide-gated channel, partial [Helianthus annuus] ADO62353.1 putative cyclic nucleotide-gated channel, partial [Helianthus annuus] ADO62360.1 putative cyclic nucleotide-gated channel, partial [Helianthus annuus] ADO62361.1 putative cyclic nucleotide-gated channel, partial [Helianthus annuus] ADO62364.1 putative cyclic nucleotide-gated channel, partial [Helianthus annuus] ADO62365.1 putative cyclic nucleotide-gated channel, partial [Helianthus annuus] ADO62368.1 putative cyclic nucleotide-gated channel, partial [Helianthus annuus] ADO62369.1 putative cyclic nucleotide-gated channel, partial [Helianthus annuus] ADO62370.1 putative cyclic nucleotide-gated channel, partial [Helianthus annuus] ADO62371.1 putative cyclic nucleotide-gated channel, partial [Helianthus annuus] ADO62372.1 putative cyclic nucleotide-gated channel, partial [Helianthus annuus] ADO62373.1 putative cyclic nucleotide-gated channel, partial [Helianthus annuus] ADO62376.1 putative cyclic nucleotide-gated channel, partial [Helianthus annuus] ADO62377.1 putative cyclic nucleotide-gated channel, partial [Helianthus annuus] ADO62378.1 putative cyclic nucleotide-gated channel, partial [Helianthus annuus] ADO62379.1 putative cyclic nucleotide-gated channel, partial [Helianthus annuus] ADO62380.1 putative cyclic nucleotide-gated channel, partial [Helianthus annuus] ADO62381.1 putative cyclic nucleotide-gated channel, partial [Helianthus annuus] ADO62382.1 putative cyclic nucleotide-gated channel, partial [Helianthus annuus] ADO62383.1 putative cyclic nucleotide-gated channel, partial [Helianthus annuus] ADO62386.1 putative cyclic nucleotide-gated channel, partial [Helianthus annuus] ADO62387.1 putative cyclic nucleotide-gated channel, partial [Helianthus annuus] ADO62388.1 putative cyclic nucleotide-gated channel, partial [Helianthus annuus] ADO62389.1 putative cyclic nucleotide-gated channel, partial [Helianthus annuus] ADO62394.1 putative cyclic nucleotide-gated channel, partial [Helianthus annuus] ADO62395.1 putative cyclic nucleotide-gated channel, partial [Helianthus annuus] ADO62396.1 putative cyclic nucleotide-gated channel, partial [Helianthus annuus] ADO62397.1 putative cyclic nucleotide-gated channel, partial [Helianthus annuus] ADO62398.1 putative cyclic nucleotide-gated channel, partial [Helianthus annuus] ADO62399.1 putative cyclic nucleotide-gated channel, partial [Helianthus annuus] ADO62409.1 putative cyclic nucleotide-gated channel, partial [Helianthus annuus] ADO62410.1 putative cyclic nucleotide-gated channel, partial [Helianthus annuus] ADO62411.1 putative cyclic nucleotide-gated channel, partial [Helianthus annuus] ADO62414.1 putative cyclic nucleotide-gated channel, partial [Helianthus annuus] ADO62415.1 putative cyclic nucleotide-gated channel, partial [Helianthus annuus] ADO62416.1 putative cyclic nucleotide-gated channel, partial [Helianthus annuus] ADO62417.1 putative cyclic nucleotide-gated channel, partial [Helianthus annuus] ADO62418.1 putative cyclic nucleotide-gated channel, partial [Helianthus annuus] ADO62419.1 putative cyclic nucleotide-gated channel, partial [Helianthus annuus] ADO62420.1 putative cyclic nucleotide-gated channel, partial [Helianthus annuus] ADO62421.1 putative cyclic nucleotide-gated channel, partial [Helianthus annuus] ADO62424.1 putative cyclic nucleotide-gated channel, partial [Helianthus annuus] ADO62425.1 putative cyclic nucleotide-gated channel, partial [Helianthus annuus] ADO62428.1 putative cyclic nucleotide-gated channel, partial [Helianthus annuus] ADO62429.1 putative cyclic nucleotide-gated channel, partial [Helianthus annuus] ADO62438.1 putative cyclic nucleotide-gated channel, partial [Helianthus annuus] ADO62439.1 putative cyclic nucleotide-gated channel, partial [Helianthus annuus] ADO62442.1 putative cyclic nucleotide-gated channel, partial [Helianthus annuus] ADO62443.1 putative cyclic nucleotide-gated channel, partial [Helianthus annuus] ADO62444.1 putative cyclic nucleotide-gated channel, partial [Helianthus annuus] ADO62445.1 putative cyclic nucleotide-gated channel, partial [Helianthus annuus] AEB37769.1 calmodulin-binding cyclic nucleotide gated channel 15, partial [Helianthus petiolaris] AEB37771.1 calmodulin-binding cyclic nucleotide gated channel 15, partial [Helianthus petiolaris] AEB37772.1 calmodulin-binding cyclic nucleotide gated channel 15, partial [Helianthus petiolaris] AEB37773.1 calmodulin-binding cyclic nucleotide gated channel 15, partial [Helianthus petiolaris] AEB37774.1 calmodulin-binding cyclic nucleotide gated channel 15, partial [Helianthus petiolaris] AEB37783.1 calmodulin-binding cyclic nucleotide gated channel 15, partial [Helianthus paradoxus] AEB37784.1 calmodulin-binding cyclic nucleotide gated channel 15, partial [Helianthus paradoxus] AEB37785.1 calmodulin-binding cyclic nucleotide gated channel 15, partial [Helianthus paradoxus] AEB37786.1 calmodulin-binding cyclic nucleotide gated channel 15, partial [Helianthus paradoxus] AEB37789.1 calmodulin-binding cyclic nucleotide gated channel 15, partial [Helianthus exilis] AEB37790.1 calmodulin-binding cyclic nucleotide gated channel 15, partial [Helianthus exilis] AEB37797.1 calmodulin-binding cyclic nucleotide gated channel 15, partial [Helianthus exilis] AEB37798.1 calmodulin-binding cyclic nucleotide gated channel 15, partial [Helianthus exilis] AEB37801.1 calmodulin-binding cyclic nucleotide gated channel 15, partial [Helianthus tuberosus] AEB37803.1 calmodulin-binding cyclic nucleotide gated channel 15, partial [Helianthus tuberosus] AEB37805.1 calmodulin-binding cyclic nucleotide gated channel 15, partial [Helianthus tuberosus] AEB37806.1 calmodulin-binding cyclic nucleotide gated channel 15, partial [Helianthus tuberosus] AEB37807.1 calmodulin-binding cyclic nucleotide gated channel 15, partial [Helianthus tuberosus] AEB37808.1 calmodulin-binding cyclic nucleotide gated channel 15, partial [Helianthus tuberosus] AEB37809.1 calmodulin-binding cyclic nucleotide gated channel 15, partial [Helianthus tuberosus] AEB37811.1 calmodulin-binding cyclic nucleotide gated channel 15, partial [Helianthus tuberosus] AEB37813.1 calmodulin-binding cyclic nucleotide gated channel 15, partial [Helianthus tuberosus] AEB37814.1 calmodulin-binding cyclic nucleotide gated channel 15, partial [Helianthus tuberosus] AEB37815.1 calmodulin-binding cyclic nucleotide gated channel 15, partial [Helianthus tuberosus] AEB37819.1 calmodulin-binding cyclic nucleotide gated channel 15, partial [Helianthus tuberosus] AEB37820.1 calmodulin-binding cyclic nucleotide gated channel 15, partial [Helianthus tuberosus] AEB37823.1 calmodulin-binding cyclic nucleotide gated channel 15, partial [Helianthus tuberosus] AEB37824.1 calmodulin-binding cyclic nucleotide gated channel 15, partial [Helianthus tuberosus] Length = 184 Score = 279 bits (714), Expect = 4e-94 Identities = 130/142 (91%), Positives = 139/142 (97%) Frame = +2 Query: 2 QGTCLVREGDPVNEMLFIIRGHLDSYTTNGGRTGFFNSCRIGPGDFCGEELLTWALDPRP 181 QGTCLVREGDPVNEMLFI+RG+LDSYTTNGGRTGFFNSCRIGPGDFCGEELLTWALDPRP Sbjct: 39 QGTCLVREGDPVNEMLFIVRGNLDSYTTNGGRTGFFNSCRIGPGDFCGEELLTWALDPRP 98 Query: 182 SVILPSSTRTVKALSEVEAFALSAEDLKFVASQFRRLHSKQLRHKFRFYSHQWRTWAACF 361 SVILPSSTRTVKA+SEVEAFAL A+DLKFVASQFRRLHSKQLRHKFRFYSHQWRTWAACF Sbjct: 99 SVILPSSTRTVKAISEVEAFALIADDLKFVASQFRRLHSKQLRHKFRFYSHQWRTWAACF 158 Query: 362 IQAAWRRFKRRKDSADLKAREN 427 +QAAWRR+KRRK + +LKARE+ Sbjct: 159 VQAAWRRYKRRKSARELKARES 180 >AEB37812.1 calmodulin-binding cyclic nucleotide gated channel 15, partial [Helianthus tuberosus] Length = 177 Score = 279 bits (713), Expect = 4e-94 Identities = 130/141 (92%), Positives = 138/141 (97%) Frame = +2 Query: 2 QGTCLVREGDPVNEMLFIIRGHLDSYTTNGGRTGFFNSCRIGPGDFCGEELLTWALDPRP 181 QGTCLVREGDPVNEMLFI+RG+LDSYTTNGGRTGFFNSCRIGPGDFCGEELLTWALDPRP Sbjct: 37 QGTCLVREGDPVNEMLFIVRGNLDSYTTNGGRTGFFNSCRIGPGDFCGEELLTWALDPRP 96 Query: 182 SVILPSSTRTVKALSEVEAFALSAEDLKFVASQFRRLHSKQLRHKFRFYSHQWRTWAACF 361 SVILPSSTRTVKA+SEVEAFAL A+DLKFVASQFRRLHSKQLRHKFRFYSHQWRTWAACF Sbjct: 97 SVILPSSTRTVKAISEVEAFALIADDLKFVASQFRRLHSKQLRHKFRFYSHQWRTWAACF 156 Query: 362 IQAAWRRFKRRKDSADLKARE 424 +QAAWRR+KRRK + +LKARE Sbjct: 157 VQAAWRRYKRRKSARELKARE 177 >AEB37778.1 calmodulin-binding cyclic nucleotide gated channel 15, partial [Helianthus paradoxus] Length = 180 Score = 278 bits (712), Expect = 6e-94 Identities = 130/142 (91%), Positives = 139/142 (97%) Frame = +2 Query: 2 QGTCLVREGDPVNEMLFIIRGHLDSYTTNGGRTGFFNSCRIGPGDFCGEELLTWALDPRP 181 QGTCLVREGDPVNEMLFI+RG+LDSYTTNGGRTGFFNSCRIGPGDFCGEELLTWALDPRP Sbjct: 37 QGTCLVREGDPVNEMLFIVRGNLDSYTTNGGRTGFFNSCRIGPGDFCGEELLTWALDPRP 96 Query: 182 SVILPSSTRTVKALSEVEAFALSAEDLKFVASQFRRLHSKQLRHKFRFYSHQWRTWAACF 361 SVILPSSTRTVKA+SEVEAFAL A+DLKFVASQFRRLHSKQLRHKFRFYSHQWRTWAACF Sbjct: 97 SVILPSSTRTVKAISEVEAFALIADDLKFVASQFRRLHSKQLRHKFRFYSHQWRTWAACF 156 Query: 362 IQAAWRRFKRRKDSADLKAREN 427 +QAAWRR+KRRK + +LKARE+ Sbjct: 157 VQAAWRRYKRRKSAWELKARES 178 >AEB37779.1 calmodulin-binding cyclic nucleotide gated channel 15, partial [Helianthus paradoxus] AEB37780.1 calmodulin-binding cyclic nucleotide gated channel 15, partial [Helianthus paradoxus] AEB37781.1 calmodulin-binding cyclic nucleotide gated channel 15, partial [Helianthus paradoxus] AEB37782.1 calmodulin-binding cyclic nucleotide gated channel 15, partial [Helianthus paradoxus] AEB37787.1 calmodulin-binding cyclic nucleotide gated channel 15, partial [Helianthus paradoxus] AEB37788.1 calmodulin-binding cyclic nucleotide gated channel 15, partial [Helianthus paradoxus] Length = 184 Score = 278 bits (712), Expect = 7e-94 Identities = 130/142 (91%), Positives = 139/142 (97%) Frame = +2 Query: 2 QGTCLVREGDPVNEMLFIIRGHLDSYTTNGGRTGFFNSCRIGPGDFCGEELLTWALDPRP 181 QGTCLVREGDPVNEMLFI+RG+LDSYTTNGGRTGFFNSCRIGPGDFCGEELLTWALDPRP Sbjct: 39 QGTCLVREGDPVNEMLFIVRGNLDSYTTNGGRTGFFNSCRIGPGDFCGEELLTWALDPRP 98 Query: 182 SVILPSSTRTVKALSEVEAFALSAEDLKFVASQFRRLHSKQLRHKFRFYSHQWRTWAACF 361 SVILPSSTRTVKA+SEVEAFAL A+DLKFVASQFRRLHSKQLRHKFRFYSHQWRTWAACF Sbjct: 99 SVILPSSTRTVKAISEVEAFALIADDLKFVASQFRRLHSKQLRHKFRFYSHQWRTWAACF 158 Query: 362 IQAAWRRFKRRKDSADLKAREN 427 +QAAWRR+KRRK + +LKARE+ Sbjct: 159 VQAAWRRYKRRKSAWELKARES 180 >AEB37817.1 calmodulin-binding cyclic nucleotide gated channel 15, partial [Helianthus tuberosus] Length = 184 Score = 278 bits (710), Expect = 1e-93 Identities = 129/142 (90%), Positives = 138/142 (97%) Frame = +2 Query: 2 QGTCLVREGDPVNEMLFIIRGHLDSYTTNGGRTGFFNSCRIGPGDFCGEELLTWALDPRP 181 QGTCLVREGDPVNEMLFI+RG+LDSYTTNGGRTGFFNSCRIGPGDFCGEELLTWALDPRP Sbjct: 39 QGTCLVREGDPVNEMLFIVRGNLDSYTTNGGRTGFFNSCRIGPGDFCGEELLTWALDPRP 98 Query: 182 SVILPSSTRTVKALSEVEAFALSAEDLKFVASQFRRLHSKQLRHKFRFYSHQWRTWAACF 361 SVILPSSTRTVKA+SEVEAFAL A+DLKFVASQFRRLHSKQLRHKFRFYSHQWRTWAACF Sbjct: 99 SVILPSSTRTVKAISEVEAFALIADDLKFVASQFRRLHSKQLRHKFRFYSHQWRTWAACF 158 Query: 362 IQAAWRRFKRRKDSADLKAREN 427 +QAAWRR+KRRK + +LK RE+ Sbjct: 159 VQAAWRRYKRRKSARELKVRES 180 >ADO62407.1 putative cyclic nucleotide-gated channel, partial [Helianthus annuus] Length = 184 Score = 278 bits (710), Expect = 1e-93 Identities = 129/142 (90%), Positives = 138/142 (97%) Frame = +2 Query: 2 QGTCLVREGDPVNEMLFIIRGHLDSYTTNGGRTGFFNSCRIGPGDFCGEELLTWALDPRP 181 QGTCL REGDPVNEMLFI+RG+LDSYTTNGGRTGFFNSCRIGPGDFCGEELLTWALDPRP Sbjct: 39 QGTCLAREGDPVNEMLFIVRGNLDSYTTNGGRTGFFNSCRIGPGDFCGEELLTWALDPRP 98 Query: 182 SVILPSSTRTVKALSEVEAFALSAEDLKFVASQFRRLHSKQLRHKFRFYSHQWRTWAACF 361 SVILPSSTRTVKA+SEVEAFAL A+DLKFVASQFRRLHSKQLRHKFRFYSHQWRTWAACF Sbjct: 99 SVILPSSTRTVKAISEVEAFALIADDLKFVASQFRRLHSKQLRHKFRFYSHQWRTWAACF 158 Query: 362 IQAAWRRFKRRKDSADLKAREN 427 +QAAWRR+KRRK + +LKARE+ Sbjct: 159 VQAAWRRYKRRKSARELKARES 180