BLASTX nr result
ID: Magnolia22_contig00009713
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Magnolia22_contig00009713 (668 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_007677827.1 hypothetical protein BAUCODRAFT_534401 [Baudoinia... 77 7e-13 >XP_007677827.1 hypothetical protein BAUCODRAFT_534401 [Baudoinia panamericana UAMH 10762] EMC95303.1 hypothetical protein BAUCODRAFT_534401 [Baudoinia panamericana UAMH 10762] Length = 354 Score = 76.6 bits (187), Expect = 7e-13 Identities = 36/57 (63%), Positives = 43/57 (75%), Gaps = 1/57 (1%) Frame = -2 Query: 460 SSGDPSGWRQEGEGTHPTLAGNMFDPQVQADGQM-SAGQGVGGTSEGRIKQEGLEHI 293 + G S W+ +G G HPTLAGNMFDP V+ADG++ S G GVGGT E I+QEGLEHI Sbjct: 6 TDGPASEWKPQGSGPHPTLAGNMFDPGVKADGKLGSTGTGVGGTDEQAIRQEGLEHI 62