BLASTX nr result
ID: Magnolia22_contig00008985
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Magnolia22_contig00008985 (577 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_016224172.1 hypothetical protein PV10_03872 [Exophiala mesoph... 82 3e-16 OAG45052.1 hypothetical protein AYO21_00400 [Fonsecaea monophora] 81 4e-16 KIV87094.1 hypothetical protein PV11_02664 [Exophiala sideris] 82 6e-16 XP_007736629.1 hypothetical protein A1O3_08341, partial [Caproni... 81 6e-16 XP_009161778.1 cellular nucleic acid-binding protein [Exophiala ... 81 7e-16 XP_007757439.1 hypothetical protein A1O7_05239, partial [Cladoph... 81 7e-16 XP_013283042.1 hypothetical protein Z517_05846 [Fonsecaea pedros... 81 7e-16 XP_007720813.1 cellular nucleic acid-binding protein [Capronia c... 81 8e-16 XP_008726009.1 hypothetical protein G647_03442 [Cladophialophora... 81 1e-15 XP_013314940.1 hypothetical protein PV05_06720 [Exophiala xenobi... 80 3e-15 OMP85326.1 Cellular nucleic acid-binding protein-like protein [D... 76 1e-14 XP_020119358.1 hypothetical protein UA08_05824 [Talaromyces atro... 77 2e-14 XP_001933997.1 cellular nucleic acid binding protein [Pyrenophor... 77 3e-14 OGE57534.1 hypothetical protein PENARI_c002G10500 [Penicillium a... 76 5e-14 KXG49467.1 Zinc finger, CCHC-type [Penicillium griseofulvum] 76 5e-14 XP_002557366.1 Pc12g05190 [Penicillium rubens Wisconsin 54-1255]... 76 5e-14 KZZ97083.1 zinc knuckle domain protein [Ascosphaera apis ARSEF 7... 76 6e-14 XP_016600390.1 Zinc finger, CCHC-type [Penicillium expansum] KGO... 76 6e-14 XP_014535283.1 hypothetical protein PDIP_34510 [Penicillium digi... 76 6e-14 EKG11203.1 Zinc finger CCHC-type protein [Macrophomina phaseolin... 76 7e-14 >XP_016224172.1 hypothetical protein PV10_03872 [Exophiala mesophila] KIV92598.1 hypothetical protein PV10_03872 [Exophiala mesophila] Length = 192 Score = 82.4 bits (202), Expect = 3e-16 Identities = 33/41 (80%), Positives = 36/41 (87%) Frame = -2 Query: 573 KCYNCGEQGHLSRDCPTPQAQERLCYKCKQPGHLASACTEA 451 KCYNCGEQGHLSRDCP+ +QER+CYKCKQPGHL SAC A Sbjct: 152 KCYNCGEQGHLSRDCPSEPSQERICYKCKQPGHLQSACPNA 192 >OAG45052.1 hypothetical protein AYO21_00400 [Fonsecaea monophora] Length = 158 Score = 81.3 bits (199), Expect = 4e-16 Identities = 32/39 (82%), Positives = 35/39 (89%) Frame = -2 Query: 576 QKCYNCGEQGHLSRDCPTPQAQERLCYKCKQPGHLASAC 460 QKCYNCGEQGHLSRDCP+ + ER+CYKCKQPGHL SAC Sbjct: 118 QKCYNCGEQGHLSRDCPSEPSSERICYKCKQPGHLQSAC 156 >KIV87094.1 hypothetical protein PV11_02664 [Exophiala sideris] Length = 205 Score = 82.0 bits (201), Expect = 6e-16 Identities = 33/39 (84%), Positives = 35/39 (89%) Frame = -2 Query: 576 QKCYNCGEQGHLSRDCPTPQAQERLCYKCKQPGHLASAC 460 QKCYNCGEQGHLSRDCP+ + ERLCYKCKQPGHL SAC Sbjct: 165 QKCYNCGEQGHLSRDCPSEPSSERLCYKCKQPGHLQSAC 203 >XP_007736629.1 hypothetical protein A1O3_08341, partial [Capronia epimyces CBS 606.96] EXJ80055.1 hypothetical protein A1O3_08341, partial [Capronia epimyces CBS 606.96] Length = 160 Score = 80.9 bits (198), Expect = 6e-16 Identities = 32/39 (82%), Positives = 35/39 (89%) Frame = -2 Query: 576 QKCYNCGEQGHLSRDCPTPQAQERLCYKCKQPGHLASAC 460 QKCYNCGEQGHLSRDCP+ + ER+CYKCKQPGHL SAC Sbjct: 120 QKCYNCGEQGHLSRDCPSEASAERICYKCKQPGHLQSAC 158 >XP_009161778.1 cellular nucleic acid-binding protein [Exophiala dermatitidis NIH/UT8656] EHY61317.1 cellular nucleic acid-binding protein [Exophiala dermatitidis NIH/UT8656] Length = 182 Score = 81.3 bits (199), Expect = 7e-16 Identities = 32/39 (82%), Positives = 35/39 (89%) Frame = -2 Query: 576 QKCYNCGEQGHLSRDCPTPQAQERLCYKCKQPGHLASAC 460 QKCYNCGEQGHLSRDCP+ + ER+CYKCKQPGHL SAC Sbjct: 142 QKCYNCGEQGHLSRDCPSEASSERICYKCKQPGHLQSAC 180 >XP_007757439.1 hypothetical protein A1O7_05239, partial [Cladophialophora yegresii CBS 114405] EXJ61086.1 hypothetical protein A1O7_05239, partial [Cladophialophora yegresii CBS 114405] Length = 168 Score = 80.9 bits (198), Expect = 7e-16 Identities = 32/39 (82%), Positives = 34/39 (87%) Frame = -2 Query: 576 QKCYNCGEQGHLSRDCPTPQAQERLCYKCKQPGHLASAC 460 QKCYNCGEQGHLSRDCP+ ER+CYKCKQPGHL SAC Sbjct: 128 QKCYNCGEQGHLSRDCPSEPTSERICYKCKQPGHLQSAC 166 >XP_013283042.1 hypothetical protein Z517_05846 [Fonsecaea pedrosoi CBS 271.37] KIW79234.1 hypothetical protein Z517_05846 [Fonsecaea pedrosoi CBS 271.37] Length = 186 Score = 81.3 bits (199), Expect = 7e-16 Identities = 32/39 (82%), Positives = 35/39 (89%) Frame = -2 Query: 576 QKCYNCGEQGHLSRDCPTPQAQERLCYKCKQPGHLASAC 460 QKCYNCGEQGHLSRDCP+ + ER+CYKCKQPGHL SAC Sbjct: 146 QKCYNCGEQGHLSRDCPSEPSSERICYKCKQPGHLQSAC 184 >XP_007720813.1 cellular nucleic acid-binding protein [Capronia coronata CBS 617.96] EXJ93319.1 cellular nucleic acid-binding protein [Capronia coronata CBS 617.96] Length = 191 Score = 81.3 bits (199), Expect = 8e-16 Identities = 32/39 (82%), Positives = 35/39 (89%) Frame = -2 Query: 576 QKCYNCGEQGHLSRDCPTPQAQERLCYKCKQPGHLASAC 460 QKCYNCGEQGHLSRDCP+ + ER+CYKCKQPGHL SAC Sbjct: 151 QKCYNCGEQGHLSRDCPSEASNERICYKCKQPGHLQSAC 189 >XP_008726009.1 hypothetical protein G647_03442 [Cladophialophora carrionii CBS 160.54] ETI24073.1 hypothetical protein G647_03442 [Cladophialophora carrionii CBS 160.54] Length = 198 Score = 80.9 bits (198), Expect = 1e-15 Identities = 32/39 (82%), Positives = 34/39 (87%) Frame = -2 Query: 576 QKCYNCGEQGHLSRDCPTPQAQERLCYKCKQPGHLASAC 460 QKCYNCGEQGHLSRDCP+ ER+CYKCKQPGHL SAC Sbjct: 158 QKCYNCGEQGHLSRDCPSEPTSERICYKCKQPGHLQSAC 196 >XP_013314940.1 hypothetical protein PV05_06720 [Exophiala xenobiotica] KIW54356.1 hypothetical protein PV05_06720 [Exophiala xenobiotica] Length = 202 Score = 80.1 bits (196), Expect = 3e-15 Identities = 31/39 (79%), Positives = 35/39 (89%) Frame = -2 Query: 576 QKCYNCGEQGHLSRDCPTPQAQERLCYKCKQPGHLASAC 460 QKCYNCGEQGHLSRDCP+ + ER+CYKCKQPGH+ SAC Sbjct: 162 QKCYNCGEQGHLSRDCPSEPSSERICYKCKQPGHVQSAC 200 >OMP85326.1 Cellular nucleic acid-binding protein-like protein [Diplodia seriata] Length = 108 Score = 75.9 bits (185), Expect = 1e-14 Identities = 29/39 (74%), Positives = 34/39 (87%) Frame = -2 Query: 576 QKCYNCGEQGHLSRDCPTPQAQERLCYKCKQPGHLASAC 460 QKCYNCGE GHLSRDCP+ + ER+CYKCKQPGH+ +AC Sbjct: 68 QKCYNCGEVGHLSRDCPSETSNERVCYKCKQPGHVQAAC 106 >XP_020119358.1 hypothetical protein UA08_05824 [Talaromyces atroroseus] OKL59237.1 hypothetical protein UA08_05824 [Talaromyces atroroseus] Length = 179 Score = 77.4 bits (189), Expect = 2e-14 Identities = 31/40 (77%), Positives = 34/40 (85%) Frame = -2 Query: 576 QKCYNCGEQGHLSRDCPTPQAQERLCYKCKQPGHLASACT 457 QKCYNCGE GH+SRDCPT ER+CYKCKQPGH+ SACT Sbjct: 139 QKCYNCGEVGHVSRDCPTEANGERVCYKCKQPGHVQSACT 178 Score = 54.3 bits (129), Expect = 8e-06 Identities = 20/39 (51%), Positives = 28/39 (71%) Frame = -2 Query: 570 CYNCGEQGHLSRDCPTPQAQERLCYKCKQPGHLASACTE 454 CYNCG QGH+SR+C P +E+ CY+C Q GH++ C + Sbjct: 31 CYNCGGQGHVSRECSQP-PKEKSCYRCNQTGHISRECRQ 68 >XP_001933997.1 cellular nucleic acid binding protein [Pyrenophora tritici-repentis Pt-1C-BFP] EDU46502.1 cellular nucleic acid binding protein [Pyrenophora tritici-repentis Pt-1C-BFP] Length = 189 Score = 77.0 bits (188), Expect = 3e-14 Identities = 30/40 (75%), Positives = 34/40 (85%) Frame = -2 Query: 576 QKCYNCGEQGHLSRDCPTPQAQERLCYKCKQPGHLASACT 457 QKCYNCGE GHLSRDCP + ER+CY+CKQPGH+ SACT Sbjct: 149 QKCYNCGEVGHLSRDCPQETSSERVCYRCKQPGHVQSACT 188 Score = 58.5 bits (140), Expect = 2e-07 Identities = 22/39 (56%), Positives = 31/39 (79%) Frame = -2 Query: 570 CYNCGEQGHLSRDCPTPQAQERLCYKCKQPGHLASACTE 454 CYNCGE+GH+SR+C +PQA E+ CY+C GH++ CT+ Sbjct: 36 CYNCGEKGHVSRECTSPQA-EKTCYRCGGTGHISRECTK 73 >OGE57534.1 hypothetical protein PENARI_c002G10500 [Penicillium arizonense] Length = 179 Score = 76.3 bits (186), Expect = 5e-14 Identities = 30/39 (76%), Positives = 33/39 (84%) Frame = -2 Query: 576 QKCYNCGEQGHLSRDCPTPQAQERLCYKCKQPGHLASAC 460 QKCYNCGE GH+SRDCPT ER+CYKCKQPGH+ SAC Sbjct: 139 QKCYNCGEVGHVSRDCPTEAKGERMCYKCKQPGHVQSAC 177 Score = 57.4 bits (137), Expect = 6e-07 Identities = 23/39 (58%), Positives = 29/39 (74%) Frame = -2 Query: 570 CYNCGEQGHLSRDCPTPQAQERLCYKCKQPGHLASACTE 454 CYNCG QGHLSR+C P A+E+ CY+C Q GHL+ C + Sbjct: 31 CYNCGGQGHLSRECQEP-AKEKSCYRCGQTGHLSRECPQ 68 >KXG49467.1 Zinc finger, CCHC-type [Penicillium griseofulvum] Length = 182 Score = 76.3 bits (186), Expect = 5e-14 Identities = 30/39 (76%), Positives = 33/39 (84%) Frame = -2 Query: 576 QKCYNCGEQGHLSRDCPTPQAQERLCYKCKQPGHLASAC 460 QKCYNCGE GH+SRDCPT ER+CYKCKQPGH+ SAC Sbjct: 142 QKCYNCGEVGHVSRDCPTEAKGERMCYKCKQPGHVQSAC 180 >XP_002557366.1 Pc12g05190 [Penicillium rubens Wisconsin 54-1255] CAP80146.1 Pc12g05190 [Penicillium rubens Wisconsin 54-1255] Length = 182 Score = 76.3 bits (186), Expect = 5e-14 Identities = 30/39 (76%), Positives = 33/39 (84%) Frame = -2 Query: 576 QKCYNCGEQGHLSRDCPTPQAQERLCYKCKQPGHLASAC 460 QKCYNCGE GH+SRDCPT ER+CYKCKQPGH+ SAC Sbjct: 142 QKCYNCGEVGHVSRDCPTEAKGERMCYKCKQPGHVQSAC 180 >KZZ97083.1 zinc knuckle domain protein [Ascosphaera apis ARSEF 7405] Length = 168 Score = 75.9 bits (185), Expect = 6e-14 Identities = 29/40 (72%), Positives = 35/40 (87%) Frame = -2 Query: 576 QKCYNCGEQGHLSRDCPTPQAQERLCYKCKQPGHLASACT 457 QKCYNCGE GH+SRDCPT + ER+CYKCK+PGH+ SAC+ Sbjct: 128 QKCYNCGEVGHVSRDCPTEASGERVCYKCKKPGHIQSACS 167 >XP_016600390.1 Zinc finger, CCHC-type [Penicillium expansum] KGO47051.1 Zinc finger, CCHC-type [Penicillium expansum] KGO59049.1 Zinc finger, CCHC-type [Penicillium expansum] KGO64056.1 Zinc finger, CCHC-type [Penicillium expansum] KOS40884.1 hypothetical protein ACN38_g8241 [Penicillium nordicum] KUM62222.1 hypothetical protein ACN42_g4871 [Penicillium freii] Length = 185 Score = 76.3 bits (186), Expect = 6e-14 Identities = 30/39 (76%), Positives = 33/39 (84%) Frame = -2 Query: 576 QKCYNCGEQGHLSRDCPTPQAQERLCYKCKQPGHLASAC 460 QKCYNCGE GH+SRDCPT ER+CYKCKQPGH+ SAC Sbjct: 145 QKCYNCGEVGHVSRDCPTEAKGERMCYKCKQPGHVQSAC 183 Score = 55.1 bits (131), Expect = 4e-06 Identities = 22/39 (56%), Positives = 28/39 (71%) Frame = -2 Query: 570 CYNCGEQGHLSRDCPTPQAQERLCYKCKQPGHLASACTE 454 CYNC QGHLSR+C P A+E+ CY+C Q GHL+ C + Sbjct: 32 CYNCNGQGHLSRECQEP-AKEKSCYRCGQTGHLSRECPQ 69 >XP_014535283.1 hypothetical protein PDIP_34510 [Penicillium digitatum Pd1] EKV12574.1 hypothetical protein PDIG_43280 [Penicillium digitatum PHI26] EKV16664.1 hypothetical protein PDIP_34510 [Penicillium digitatum Pd1] Length = 185 Score = 76.3 bits (186), Expect = 6e-14 Identities = 30/39 (76%), Positives = 33/39 (84%) Frame = -2 Query: 576 QKCYNCGEQGHLSRDCPTPQAQERLCYKCKQPGHLASAC 460 QKCYNCGE GH+SRDCPT ER+CYKCKQPGH+ SAC Sbjct: 145 QKCYNCGEVGHVSRDCPTEAKGERMCYKCKQPGHVQSAC 183 Score = 55.1 bits (131), Expect = 4e-06 Identities = 22/39 (56%), Positives = 28/39 (71%) Frame = -2 Query: 570 CYNCGEQGHLSRDCPTPQAQERLCYKCKQPGHLASACTE 454 CYNC QGHLSR+C P A+E+ CY+C Q GHL+ C + Sbjct: 32 CYNCNGQGHLSRECQEP-AKEKSCYRCGQTGHLSRECPQ 69 >EKG11203.1 Zinc finger CCHC-type protein [Macrophomina phaseolina MS6] Length = 176 Score = 75.9 bits (185), Expect = 7e-14 Identities = 29/39 (74%), Positives = 34/39 (87%) Frame = -2 Query: 576 QKCYNCGEQGHLSRDCPTPQAQERLCYKCKQPGHLASAC 460 QKCYNCGE GHLSRDCP+ + ER+CYKCKQPGH+ +AC Sbjct: 136 QKCYNCGEVGHLSRDCPSETSNERVCYKCKQPGHVQAAC 174 Score = 62.0 bits (149), Expect = 1e-08 Identities = 26/39 (66%), Positives = 30/39 (76%) Frame = -2 Query: 570 CYNCGEQGHLSRDCPTPQAQERLCYKCKQPGHLASACTE 454 CYNCGEQGHLSRDC PQA E+ CY+C + GHL+ C E Sbjct: 32 CYNCGEQGHLSRDCQQPQA-EKPCYRCGKVGHLSRECPE 69