BLASTX nr result
ID: Magnolia22_contig00008857
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Magnolia22_contig00008857 (425 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value EEF21878.1 conserved hypothetical protein [Ricinus communis] 57 2e-08 KDO40736.1 hypothetical protein CISIN_1g0295431mg, partial [Citr... 57 7e-08 XP_020080289.1 2-alkenal reductase (NADP(+)-dependent)-like [Ana... 59 9e-08 XP_006441039.1 hypothetical protein CICLE_v10023259mg, partial [... 57 2e-07 XP_013443885.1 NADP-dependent alkenal double bond reductase P2, ... 58 2e-07 XP_006478023.1 PREDICTED: 2-alkenal reductase (NADP(+)-dependent... 57 3e-07 XP_006478022.1 PREDICTED: NADP-dependent alkenal double bond red... 57 3e-07 XP_017182386.1 PREDICTED: 2-alkenal reductase (NADP(+)-dependent... 58 3e-07 XP_019160350.1 PREDICTED: 2-alkenal reductase (NADP(+)-dependent... 58 4e-07 XP_012839046.1 PREDICTED: 2-alkenal reductase (NADP(+)-dependent... 58 4e-07 XP_008367739.1 PREDICTED: 2-alkenal reductase (NADP(+)-dependent... 58 4e-07 XP_019160349.1 PREDICTED: 2-alkenal reductase (NADP(+)-dependent... 58 4e-07 KZV32797.1 hypothetical protein F511_23709 [Dorcoceras hygrometr... 57 6e-07 OMO79407.1 Alcohol dehydrogenase superfamily, zinc-type [Corchor... 57 6e-07 KZV48483.1 hypothetical protein F511_18289 [Dorcoceras hygrometr... 57 6e-07 OAY59266.1 hypothetical protein MANES_01G018700 [Manihot esculenta] 57 6e-07 KFK37749.1 hypothetical protein AALP_AA3G025100 [Arabis alpina] 57 8e-07 XP_016514080.1 PREDICTED: 2-alkenal reductase (NADP(+)-dependent... 54 9e-07 EOY04548.1 Zinc-binding dehydrogenase family protein isoform 2 [... 55 1e-06 XP_011085050.1 PREDICTED: 2-alkenal reductase (NADP(+)-dependent... 57 1e-06 >EEF21878.1 conserved hypothetical protein [Ricinus communis] Length = 50 Score = 56.6 bits (135), Expect = 2e-08 Identities = 25/30 (83%), Positives = 29/30 (96%) Frame = +3 Query: 3 KVDLLKSKFGFDNAFNYKEEPDLNVALKRS 92 KVD+LK+KFGFD+AFNYKEEPDL+ ALKRS Sbjct: 8 KVDMLKNKFGFDDAFNYKEEPDLDAALKRS 37 >KDO40736.1 hypothetical protein CISIN_1g0295431mg, partial [Citrus sinensis] Length = 127 Score = 57.4 bits (137), Expect = 7e-08 Identities = 26/29 (89%), Positives = 29/29 (100%) Frame = +3 Query: 3 KVDLLKSKFGFDNAFNYKEEPDLNVALKR 89 KVDLLK+KFGFD+AFNYKEEPDL+VALKR Sbjct: 55 KVDLLKNKFGFDDAFNYKEEPDLDVALKR 83 >XP_020080289.1 2-alkenal reductase (NADP(+)-dependent)-like [Ananas comosus] Length = 266 Score = 59.3 bits (142), Expect = 9e-08 Identities = 28/38 (73%), Positives = 31/38 (81%) Frame = +3 Query: 3 KVDLLKSKFGFDNAFNYKEEPDLNVALKRSTAPVDHTG 116 KVDLLK+KFGFD+AFNYKEE DLN ALKR +AP G Sbjct: 194 KVDLLKNKFGFDDAFNYKEEKDLNAALKRLSAPAAAAG 231 >XP_006441039.1 hypothetical protein CICLE_v10023259mg, partial [Citrus clementina] ESR54279.1 hypothetical protein CICLE_v10023259mg, partial [Citrus clementina] Length = 186 Score = 57.4 bits (137), Expect = 2e-07 Identities = 26/29 (89%), Positives = 29/29 (100%) Frame = +3 Query: 3 KVDLLKSKFGFDNAFNYKEEPDLNVALKR 89 KVDLLK+KFGFD+AFNYKEEPDL+VALKR Sbjct: 139 KVDLLKNKFGFDDAFNYKEEPDLDVALKR 167 >XP_013443885.1 NADP-dependent alkenal double bond reductase P2, partial [Medicago truncatula] KEH17910.1 NADP-dependent alkenal double bond reductase P2, partial [Medicago truncatula] Length = 226 Score = 57.8 bits (138), Expect = 2e-07 Identities = 26/30 (86%), Positives = 28/30 (93%) Frame = +3 Query: 3 KVDLLKSKFGFDNAFNYKEEPDLNVALKRS 92 KVDLLK+KFG+D AFNYKEEPDLN ALKRS Sbjct: 190 KVDLLKNKFGYDEAFNYKEEPDLNAALKRS 219 >XP_006478023.1 PREDICTED: 2-alkenal reductase (NADP(+)-dependent)-like isoform X2 [Citrus sinensis] Length = 217 Score = 57.4 bits (137), Expect = 3e-07 Identities = 26/29 (89%), Positives = 29/29 (100%) Frame = +3 Query: 3 KVDLLKSKFGFDNAFNYKEEPDLNVALKR 89 KVDLLK+KFGFD+AFNYKEEPDL+VALKR Sbjct: 145 KVDLLKNKFGFDDAFNYKEEPDLDVALKR 173 >XP_006478022.1 PREDICTED: NADP-dependent alkenal double bond reductase P2-like isoform X1 [Citrus sinensis] Length = 218 Score = 57.4 bits (137), Expect = 3e-07 Identities = 26/29 (89%), Positives = 29/29 (100%) Frame = +3 Query: 3 KVDLLKSKFGFDNAFNYKEEPDLNVALKR 89 KVDLLK+KFGFD+AFNYKEEPDL+VALKR Sbjct: 146 KVDLLKNKFGFDDAFNYKEEPDLDVALKR 174 >XP_017182386.1 PREDICTED: 2-alkenal reductase (NADP(+)-dependent)-like [Malus domestica] Length = 273 Score = 57.8 bits (138), Expect = 3e-07 Identities = 26/29 (89%), Positives = 28/29 (96%) Frame = +3 Query: 3 KVDLLKSKFGFDNAFNYKEEPDLNVALKR 89 KVDLLK+KFGFDNAFNYKEEPDL+ ALKR Sbjct: 120 KVDLLKNKFGFDNAFNYKEEPDLDAALKR 148 >XP_019160350.1 PREDICTED: 2-alkenal reductase (NADP(+)-dependent)-like [Ipomoea nil] Length = 342 Score = 57.8 bits (138), Expect = 4e-07 Identities = 26/29 (89%), Positives = 28/29 (96%) Frame = +3 Query: 3 KVDLLKSKFGFDNAFNYKEEPDLNVALKR 89 KVDLLK+KFGFD+AFNYKEEPDLN ALKR Sbjct: 189 KVDLLKNKFGFDDAFNYKEEPDLNAALKR 217 >XP_012839046.1 PREDICTED: 2-alkenal reductase (NADP(+)-dependent)-like [Erythranthe guttata] EYU36663.1 hypothetical protein MIMGU_mgv1a009314mg [Erythranthe guttata] Length = 346 Score = 57.8 bits (138), Expect = 4e-07 Identities = 26/29 (89%), Positives = 28/29 (96%) Frame = +3 Query: 3 KVDLLKSKFGFDNAFNYKEEPDLNVALKR 89 KVDLLK+KFGFD+AFNYKEEPDLN ALKR Sbjct: 193 KVDLLKNKFGFDDAFNYKEEPDLNAALKR 221 >XP_008367739.1 PREDICTED: 2-alkenal reductase (NADP(+)-dependent)-like [Malus domestica] Length = 349 Score = 57.8 bits (138), Expect = 4e-07 Identities = 26/29 (89%), Positives = 28/29 (96%) Frame = +3 Query: 3 KVDLLKSKFGFDNAFNYKEEPDLNVALKR 89 KVDLLK+KFGFDNAFNYKEEPDL+ ALKR Sbjct: 196 KVDLLKNKFGFDNAFNYKEEPDLDAALKR 224 >XP_019160349.1 PREDICTED: 2-alkenal reductase (NADP(+)-dependent)-like [Ipomoea nil] Length = 378 Score = 57.8 bits (138), Expect = 4e-07 Identities = 26/29 (89%), Positives = 28/29 (96%) Frame = +3 Query: 3 KVDLLKSKFGFDNAFNYKEEPDLNVALKR 89 KVDLLK+KFGFD+AFNYKEEPDLN ALKR Sbjct: 225 KVDLLKNKFGFDDAFNYKEEPDLNAALKR 253 >KZV32797.1 hypothetical protein F511_23709 [Dorcoceras hygrometricum] Length = 341 Score = 57.4 bits (137), Expect = 6e-07 Identities = 26/29 (89%), Positives = 27/29 (93%) Frame = +3 Query: 3 KVDLLKSKFGFDNAFNYKEEPDLNVALKR 89 KVDLLK+KFGFD AFNYKEEPDLN ALKR Sbjct: 188 KVDLLKNKFGFDEAFNYKEEPDLNAALKR 216 >OMO79407.1 Alcohol dehydrogenase superfamily, zinc-type [Corchorus olitorius] Length = 345 Score = 57.4 bits (137), Expect = 6e-07 Identities = 26/29 (89%), Positives = 27/29 (93%) Frame = +3 Query: 3 KVDLLKSKFGFDNAFNYKEEPDLNVALKR 89 KVDLLK+KFGFD AFNYKEEPDLN ALKR Sbjct: 192 KVDLLKNKFGFDEAFNYKEEPDLNAALKR 220 >KZV48483.1 hypothetical protein F511_18289 [Dorcoceras hygrometricum] Length = 345 Score = 57.4 bits (137), Expect = 6e-07 Identities = 26/29 (89%), Positives = 27/29 (93%) Frame = +3 Query: 3 KVDLLKSKFGFDNAFNYKEEPDLNVALKR 89 KVDLLK+KFGFD AFNYKEEPDLN ALKR Sbjct: 192 KVDLLKNKFGFDEAFNYKEEPDLNAALKR 220 >OAY59266.1 hypothetical protein MANES_01G018700 [Manihot esculenta] Length = 348 Score = 57.4 bits (137), Expect = 6e-07 Identities = 26/29 (89%), Positives = 27/29 (93%) Frame = +3 Query: 3 KVDLLKSKFGFDNAFNYKEEPDLNVALKR 89 KVDLLK+KFGFD AFNYKEEPDLN ALKR Sbjct: 195 KVDLLKNKFGFDEAFNYKEEPDLNAALKR 223 >KFK37749.1 hypothetical protein AALP_AA3G025100 [Arabis alpina] Length = 345 Score = 57.0 bits (136), Expect = 8e-07 Identities = 26/29 (89%), Positives = 28/29 (96%) Frame = +3 Query: 3 KVDLLKSKFGFDNAFNYKEEPDLNVALKR 89 KVDLLK+KFGFD AFNYKEEPDL+VALKR Sbjct: 192 KVDLLKNKFGFDEAFNYKEEPDLSVALKR 220 >XP_016514080.1 PREDICTED: 2-alkenal reductase (NADP(+)-dependent)-like [Nicotiana tabacum] Length = 87 Score = 53.5 bits (127), Expect = 9e-07 Identities = 25/29 (86%), Positives = 26/29 (89%) Frame = +3 Query: 3 KVDLLKSKFGFDNAFNYKEEPDLNVALKR 89 KVDLLKSKFGFD AFNYKEE DL+ ALKR Sbjct: 59 KVDLLKSKFGFDEAFNYKEEQDLSAALKR 87 >EOY04548.1 Zinc-binding dehydrogenase family protein isoform 2 [Theobroma cacao] Length = 161 Score = 55.1 bits (131), Expect = 1e-06 Identities = 24/29 (82%), Positives = 28/29 (96%) Frame = +3 Query: 3 KVDLLKSKFGFDNAFNYKEEPDLNVALKR 89 +V+LLK+KFGFD+AFNYKEEPDLN ALKR Sbjct: 7 RVELLKNKFGFDDAFNYKEEPDLNAALKR 35 >XP_011085050.1 PREDICTED: 2-alkenal reductase (NADP(+)-dependent)-like [Sesamum indicum] Length = 344 Score = 56.6 bits (135), Expect = 1e-06 Identities = 25/29 (86%), Positives = 28/29 (96%) Frame = +3 Query: 3 KVDLLKSKFGFDNAFNYKEEPDLNVALKR 89 KVDLLK+KFG+D+AFNYKEEPDLN ALKR Sbjct: 191 KVDLLKNKFGYDDAFNYKEEPDLNAALKR 219