BLASTX nr result
ID: Magnolia22_contig00008597
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Magnolia22_contig00008597 (350 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value OJJ64850.1 hypothetical protein ASPSYDRAFT_139069, partial [Aspe... 92 9e-23 OJJ41357.1 hypothetical protein ASPWEDRAFT_99996, partial [Asper... 92 9e-23 XP_001542836.1 60S ribosomal protein L39 [Histoplasma capsulatum... 92 1e-22 XP_016588327.1 large subunit ribosomal protein L39e [Sporothrix ... 92 1e-22 EPS27305.1 hypothetical protein PDE_02248 [Penicillium oxalicum ... 92 1e-22 XP_014076456.1 hypothetical protein COCC4DRAFT_145443, partial [... 92 1e-22 XP_001242303.1 60S ribosomal protein L39 [Coccidioides immitis R... 92 1e-22 KXH37219.1 hypothetical protein CNYM01_09084 [Colletotrichum nym... 92 1e-22 KXH27559.1 hypothetical protein CSIM01_13165 [Colletotrichum sim... 92 1e-22 KFX44402.1 60S ribosomal protein L39, partial [Talaromyces marne... 92 1e-22 KEY67153.1 hypothetical protein S7711_03013 [Stachybotrys charta... 92 1e-22 CCF37051.1 60S ribosomal protein L39 [Colletotrichum higginsianum] 92 1e-22 XP_013947078.1 hypothetical protein TRIATDRAFT_254996 [Trichoder... 92 1e-22 XP_006961218.1 ribosomal protein L39e [Trichoderma reesei QM6a] ... 92 1e-22 XP_008088900.1 ribosomal L39 protein [Colletotrichum graminicola... 92 1e-22 OHW95071.1 60s ribosomal protein l39 [Colletotrichum incanum] 92 2e-22 KFA67427.1 hypothetical protein S40285_00218 [Stachybotrys chlor... 92 2e-22 OMP89185.1 60S ribosomal protein L39, partial [Diplodia seriata] 92 2e-22 XP_007926934.1 hypothetical protein MYCFIDRAFT_30141, partial [P... 92 2e-22 ENH81096.1 60s ribosomal protein l39 [Colletotrichum orbiculare ... 92 2e-22 >OJJ64850.1 hypothetical protein ASPSYDRAFT_139069, partial [Aspergillus sydowii CBS 593.65] Length = 49 Score = 92.4 bits (228), Expect = 9e-23 Identities = 42/43 (97%), Positives = 43/43 (100%) Frame = -1 Query: 350 TKQKLAKAQKQNRPIPQWIRLRTGNTIRYNAKRRHWRKTKLGI 222 TKQKLAKAQKQNRPIPQWIRLRTGNTIRYNAKRRHWRKT+LGI Sbjct: 7 TKQKLAKAQKQNRPIPQWIRLRTGNTIRYNAKRRHWRKTRLGI 49 >OJJ41357.1 hypothetical protein ASPWEDRAFT_99996, partial [Aspergillus wentii DTO 134E9] OJJ48821.1 hypothetical protein ASPZODRAFT_60796, partial [Penicilliopsis zonata CBS 506.65] Length = 49 Score = 92.4 bits (228), Expect = 9e-23 Identities = 42/43 (97%), Positives = 43/43 (100%) Frame = -1 Query: 350 TKQKLAKAQKQNRPIPQWIRLRTGNTIRYNAKRRHWRKTKLGI 222 TKQKLAKAQKQNRPIPQWIRLRTGNTIRYNAKRRHWRKT+LGI Sbjct: 7 TKQKLAKAQKQNRPIPQWIRLRTGNTIRYNAKRRHWRKTRLGI 49 >XP_001542836.1 60S ribosomal protein L39 [Histoplasma capsulatum NAm1] XP_003230906.1 60S ribosomal protein L39 [Trichophyton rubrum CBS 118892] XP_003712476.1 60S ribosomal protein L39 [Magnaporthe oryzae 70-15] XP_007599880.1 hypothetical protein CFIO01_13564 [Colletotrichum fioriniae PJ7] XP_008022948.1 hypothetical protein SETTUDRAFT_46231 [Setosphaeria turcica Et28A] XP_009219929.1 60S ribosomal protein L39 [Gaeumannomyces tritici R3-111a-1] EDN06404.1 ribosomal protein L39 [Histoplasma capsulatum NAm1] CBF86564.1 TPA: conserved hypothetical protein [Aspergillus nidulans FGSC A4] EHA52669.1 60S ribosomal protein L39 [Magnaporthe oryzae 70-15] EJT78784.1 60S ribosomal protein L39 [Gaeumannomyces tritici R3-111a-1] ELQ44608.1 hypothetical protein OOU_Y34scaffold00071g24 [Magnaporthe oryzae Y34] ELQ67556.1 hypothetical protein OOW_P131scaffold00314g129 [Magnaporthe oryzae P131] EOA89386.1 hypothetical protein SETTUDRAFT_46231 [Setosphaeria turcica Et28A] ERS99941.1 60S ribosomal protein L39 [Sporothrix schenckii ATCC 58251] EXF76478.1 hypothetical protein CFIO01_13564 [Colletotrichum fioriniae PJ7] EZF28033.1 60S ribosomal protein L39 [Trichophyton rubrum MR850] EZF47097.1 60S ribosomal protein L39 [Trichophyton rubrum CBS 100081] EZF57748.1 60S ribosomal protein L39 [Trichophyton rubrum CBS 288.86] EZF68319.1 60S ribosomal protein L39 [Trichophyton rubrum CBS 289.86] EZF79023.1 60S ribosomal protein L39 [Trichophyton soudanense CBS 452.61] EZF89637.1 60S ribosomal protein L39 [Trichophyton rubrum MR1448] EZG00476.1 60S ribosomal protein L39 [Trichophyton rubrum MR1459] EZG05683.1 60S ribosomal protein L39 [Trichophyton rubrum CBS 735.88] EZG22078.1 60S ribosomal protein L39 [Trichophyton rubrum CBS 202.88] KDB38828.1 60S ribosomal protein L39 [Trichophyton rubrum D6] KLU81216.1 60S ribosomal protein L39 [Magnaporthiopsis poae ATCC 64411] CEL09978.1 Putative 60S ribosomal protein L39 [Aspergillus calidoustus] OHE95651.1 hypothetical protein CORC01_09083 [Colletotrichum orchidophilum] GAW11006.1 hypothetical protein ANO14919_003450 [fungal sp. No.14919] Length = 51 Score = 92.4 bits (228), Expect = 1e-22 Identities = 42/43 (97%), Positives = 43/43 (100%) Frame = -1 Query: 350 TKQKLAKAQKQNRPIPQWIRLRTGNTIRYNAKRRHWRKTKLGI 222 TKQKLAKAQKQNRPIPQWIRLRTGNTIRYNAKRRHWRKT+LGI Sbjct: 9 TKQKLAKAQKQNRPIPQWIRLRTGNTIRYNAKRRHWRKTRLGI 51 >XP_016588327.1 large subunit ribosomal protein L39e [Sporothrix schenckii 1099-18] KJR85651.1 large subunit ribosomal protein L39e [Sporothrix schenckii 1099-18] Length = 51 Score = 92.4 bits (228), Expect = 1e-22 Identities = 42/43 (97%), Positives = 43/43 (100%) Frame = -1 Query: 350 TKQKLAKAQKQNRPIPQWIRLRTGNTIRYNAKRRHWRKTKLGI 222 TKQKLAKAQKQNRPIPQWIRLRTGNTIRYNAKRRHWRKT+LGI Sbjct: 9 TKQKLAKAQKQNRPIPQWIRLRTGNTIRYNAKRRHWRKTRLGI 51 >EPS27305.1 hypothetical protein PDE_02248 [Penicillium oxalicum 114-2] Length = 51 Score = 92.4 bits (228), Expect = 1e-22 Identities = 42/43 (97%), Positives = 43/43 (100%) Frame = -1 Query: 350 TKQKLAKAQKQNRPIPQWIRLRTGNTIRYNAKRRHWRKTKLGI 222 TKQKLAKAQKQNRPIPQWIRLRTGNTIRYNAKRRHWRKT+LGI Sbjct: 9 TKQKLAKAQKQNRPIPQWIRLRTGNTIRYNAKRRHWRKTRLGI 51 >XP_014076456.1 hypothetical protein COCC4DRAFT_145443, partial [Bipolaris maydis ATCC 48331] ENI02547.1 hypothetical protein COCC4DRAFT_145443, partial [Bipolaris maydis ATCC 48331] Length = 51 Score = 92.4 bits (228), Expect = 1e-22 Identities = 42/43 (97%), Positives = 43/43 (100%) Frame = -1 Query: 350 TKQKLAKAQKQNRPIPQWIRLRTGNTIRYNAKRRHWRKTKLGI 222 TKQKLAKAQKQNRPIPQWIRLRTGNTIRYNAKRRHWRKT+LGI Sbjct: 9 TKQKLAKAQKQNRPIPQWIRLRTGNTIRYNAKRRHWRKTRLGI 51 >XP_001242303.1 60S ribosomal protein L39 [Coccidioides immitis RS] XP_003069553.1 60S ribosomal protein L39 [Coccidioides posadasii C735 delta SOWgp] XP_007686227.1 hypothetical protein COCMIDRAFT_3805 [Bipolaris oryzae ATCC 44560] XP_007697307.1 hypothetical protein COCSADRAFT_111781 [Bipolaris sorokiniana ND90Pr] XP_007707561.1 hypothetical protein COCCADRAFT_1122 [Bipolaris zeicola 26-R-13] XP_014559883.1 hypothetical protein COCVIDRAFT_23909 [Bipolaris victoriae FI3] EER27408.1 60S ribosomal protein L39, putative [Coccidioides posadasii C735 delta SOWgp] EFW22985.1 hypothetical protein CPSG_00884 [Coccidioides posadasii str. Silveira] EMD67723.1 hypothetical protein COCSADRAFT_111781 [Bipolaris sorokiniana ND90Pr] EMD91969.1 hypothetical protein COCHEDRAFT_1223922 [Bipolaris maydis C5] EUC38088.1 hypothetical protein COCCADRAFT_1122 [Bipolaris zeicola 26-R-13] EUC47244.1 hypothetical protein COCMIDRAFT_3805 [Bipolaris oryzae ATCC 44560] EUN30389.1 hypothetical protein COCVIDRAFT_23909 [Bipolaris victoriae FI3] KFX44403.1 60S ribosomal protein L39 [Talaromyces marneffei PM1] EAS30720.3 60S ribosomal protein L39 [Coccidioides immitis RS] KMM67224.1 hypothetical protein CPAG_03559 [Coccidioides posadasii RMSCC 3488] KMP03296.1 hypothetical protein CIRG_02988 [Coccidioides immitis RMSCC 2394] KMU80282.1 hypothetical protein CISG_08388 [Coccidioides immitis RMSCC 3703] KMU84880.1 hypothetical protein CIHG_02663 [Coccidioides immitis H538.4] OAL02628.1 putative 60S ribosomal protein L39 [Stagonospora sp. SRC1lsM3a] OJI98962.1 hypothetical protein ASPVEDRAFT_38429 [Aspergillus versicolor CBS 583.65] Length = 51 Score = 92.4 bits (228), Expect = 1e-22 Identities = 42/43 (97%), Positives = 43/43 (100%) Frame = -1 Query: 350 TKQKLAKAQKQNRPIPQWIRLRTGNTIRYNAKRRHWRKTKLGI 222 TKQKLAKAQKQNRPIPQWIRLRTGNTIRYNAKRRHWRKT+LGI Sbjct: 9 TKQKLAKAQKQNRPIPQWIRLRTGNTIRYNAKRRHWRKTRLGI 51 >KXH37219.1 hypothetical protein CNYM01_09084 [Colletotrichum nymphaeae SA-01] Length = 58 Score = 92.4 bits (228), Expect = 1e-22 Identities = 42/43 (97%), Positives = 43/43 (100%) Frame = -1 Query: 350 TKQKLAKAQKQNRPIPQWIRLRTGNTIRYNAKRRHWRKTKLGI 222 TKQKLAKAQKQNRPIPQWIRLRTGNTIRYNAKRRHWRKT+LGI Sbjct: 16 TKQKLAKAQKQNRPIPQWIRLRTGNTIRYNAKRRHWRKTRLGI 58 >KXH27559.1 hypothetical protein CSIM01_13165 [Colletotrichum simmondsii] Length = 58 Score = 92.4 bits (228), Expect = 1e-22 Identities = 42/43 (97%), Positives = 43/43 (100%) Frame = -1 Query: 350 TKQKLAKAQKQNRPIPQWIRLRTGNTIRYNAKRRHWRKTKLGI 222 TKQKLAKAQKQNRPIPQWIRLRTGNTIRYNAKRRHWRKT+LGI Sbjct: 16 TKQKLAKAQKQNRPIPQWIRLRTGNTIRYNAKRRHWRKTRLGI 58 >KFX44402.1 60S ribosomal protein L39, partial [Talaromyces marneffei PM1] Length = 64 Score = 92.4 bits (228), Expect = 1e-22 Identities = 42/43 (97%), Positives = 43/43 (100%) Frame = -1 Query: 350 TKQKLAKAQKQNRPIPQWIRLRTGNTIRYNAKRRHWRKTKLGI 222 TKQKLAKAQKQNRPIPQWIRLRTGNTIRYNAKRRHWRKT+LGI Sbjct: 22 TKQKLAKAQKQNRPIPQWIRLRTGNTIRYNAKRRHWRKTRLGI 64 >KEY67153.1 hypothetical protein S7711_03013 [Stachybotrys chartarum IBT 7711] KFA46797.1 hypothetical protein S40293_06785 [Stachybotrys chartarum IBT 40293] KFA75011.1 hypothetical protein S40288_02227 [Stachybotrys chartarum IBT 40288] Length = 51 Score = 92.0 bits (227), Expect = 1e-22 Identities = 41/43 (95%), Positives = 43/43 (100%) Frame = -1 Query: 350 TKQKLAKAQKQNRPIPQWIRLRTGNTIRYNAKRRHWRKTKLGI 222 TKQKLAKAQKQNRP+PQWIRLRTGNTIRYNAKRRHWRKT+LGI Sbjct: 9 TKQKLAKAQKQNRPVPQWIRLRTGNTIRYNAKRRHWRKTRLGI 51 >CCF37051.1 60S ribosomal protein L39 [Colletotrichum higginsianum] Length = 51 Score = 92.0 bits (227), Expect = 1e-22 Identities = 42/43 (97%), Positives = 43/43 (100%) Frame = -1 Query: 350 TKQKLAKAQKQNRPIPQWIRLRTGNTIRYNAKRRHWRKTKLGI 222 TKQKLAKAQKQNRPIPQWIRLRTGNTIRYNAKRRHWRK+KLGI Sbjct: 9 TKQKLAKAQKQNRPIPQWIRLRTGNTIRYNAKRRHWRKSKLGI 51 >XP_013947078.1 hypothetical protein TRIATDRAFT_254996 [Trichoderma atroviride IMI 206040] EHK48913.1 hypothetical protein TRIATDRAFT_254996 [Trichoderma atroviride IMI 206040] Length = 51 Score = 92.0 bits (227), Expect = 1e-22 Identities = 41/43 (95%), Positives = 43/43 (100%) Frame = -1 Query: 350 TKQKLAKAQKQNRPIPQWIRLRTGNTIRYNAKRRHWRKTKLGI 222 TKQKLAKAQKQNRP+PQWIRLRTGNTIRYNAKRRHWRKT+LGI Sbjct: 9 TKQKLAKAQKQNRPVPQWIRLRTGNTIRYNAKRRHWRKTRLGI 51 >XP_006961218.1 ribosomal protein L39e [Trichoderma reesei QM6a] XP_013958902.1 hypothetical protein TRIVIDRAFT_91630 [Trichoderma virens Gv29-8] EGR52264.1 ribosomal protein L39e [Trichoderma reesei QM6a] EHK24699.1 hypothetical protein TRIVIDRAFT_91630 [Trichoderma virens Gv29-8] ETS06462.1 ribosomal protein L39e [Trichoderma reesei RUT C-30] Length = 51 Score = 92.0 bits (227), Expect = 1e-22 Identities = 41/43 (95%), Positives = 43/43 (100%) Frame = -1 Query: 350 TKQKLAKAQKQNRPIPQWIRLRTGNTIRYNAKRRHWRKTKLGI 222 TKQKLAKAQKQNRP+PQWIRLRTGNTIRYNAKRRHWRKT+LGI Sbjct: 9 TKQKLAKAQKQNRPVPQWIRLRTGNTIRYNAKRRHWRKTRLGI 51 >XP_008088900.1 ribosomal L39 protein [Colletotrichum graminicola M1.001] EFQ24880.1 ribosomal L39 protein [Colletotrichum graminicola M1.001] Length = 51 Score = 92.0 bits (227), Expect = 1e-22 Identities = 42/43 (97%), Positives = 43/43 (100%) Frame = -1 Query: 350 TKQKLAKAQKQNRPIPQWIRLRTGNTIRYNAKRRHWRKTKLGI 222 TKQKLAKAQKQNRPIPQWIRLRTGNTIRYNAKRRHWRK+KLGI Sbjct: 9 TKQKLAKAQKQNRPIPQWIRLRTGNTIRYNAKRRHWRKSKLGI 51 >OHW95071.1 60s ribosomal protein l39 [Colletotrichum incanum] Length = 63 Score = 92.0 bits (227), Expect = 2e-22 Identities = 42/43 (97%), Positives = 43/43 (100%) Frame = -1 Query: 350 TKQKLAKAQKQNRPIPQWIRLRTGNTIRYNAKRRHWRKTKLGI 222 TKQKLAKAQKQNRPIPQWIRLRTGNTIRYNAKRRHWRK+KLGI Sbjct: 21 TKQKLAKAQKQNRPIPQWIRLRTGNTIRYNAKRRHWRKSKLGI 63 >KFA67427.1 hypothetical protein S40285_00218 [Stachybotrys chlorohalonata IBT 40285] Length = 63 Score = 92.0 bits (227), Expect = 2e-22 Identities = 41/43 (95%), Positives = 43/43 (100%) Frame = -1 Query: 350 TKQKLAKAQKQNRPIPQWIRLRTGNTIRYNAKRRHWRKTKLGI 222 TKQKLAKAQKQNRP+PQWIRLRTGNTIRYNAKRRHWRKT+LGI Sbjct: 21 TKQKLAKAQKQNRPVPQWIRLRTGNTIRYNAKRRHWRKTRLGI 63 >OMP89185.1 60S ribosomal protein L39, partial [Diplodia seriata] Length = 49 Score = 91.7 bits (226), Expect = 2e-22 Identities = 41/43 (95%), Positives = 43/43 (100%) Frame = -1 Query: 350 TKQKLAKAQKQNRPIPQWIRLRTGNTIRYNAKRRHWRKTKLGI 222 TKQKLAKAQKQNRPIPQWIRLRTGNTIRYNAKRRHWRKT++GI Sbjct: 7 TKQKLAKAQKQNRPIPQWIRLRTGNTIRYNAKRRHWRKTRIGI 49 >XP_007926934.1 hypothetical protein MYCFIDRAFT_30141, partial [Pseudocercospora fijiensis CIRAD86] EME82094.1 hypothetical protein MYCFIDRAFT_30141, partial [Pseudocercospora fijiensis CIRAD86] Length = 49 Score = 91.7 bits (226), Expect = 2e-22 Identities = 41/43 (95%), Positives = 43/43 (100%) Frame = -1 Query: 350 TKQKLAKAQKQNRPIPQWIRLRTGNTIRYNAKRRHWRKTKLGI 222 TKQKLAKAQKQNRPIPQWIRLRTGNTIRYNAKRRHWRKT++GI Sbjct: 7 TKQKLAKAQKQNRPIPQWIRLRTGNTIRYNAKRRHWRKTRIGI 49 >ENH81096.1 60s ribosomal protein l39 [Colletotrichum orbiculare MAFF 240422] Length = 77 Score = 92.4 bits (228), Expect = 2e-22 Identities = 42/43 (97%), Positives = 43/43 (100%) Frame = -1 Query: 350 TKQKLAKAQKQNRPIPQWIRLRTGNTIRYNAKRRHWRKTKLGI 222 TKQKLAKAQKQNRPIPQWIRLRTGNTIRYNAKRRHWRKT+LGI Sbjct: 35 TKQKLAKAQKQNRPIPQWIRLRTGNTIRYNAKRRHWRKTRLGI 77