BLASTX nr result
ID: Magnolia22_contig00007130
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Magnolia22_contig00007130 (479 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value JAT47212.1 ATP-dependent dethiobiotin synthetase BioD, partial [... 56 5e-07 >JAT47212.1 ATP-dependent dethiobiotin synthetase BioD, partial [Anthurium amnicola] Length = 130 Score = 55.8 bits (133), Expect = 5e-07 Identities = 24/59 (40%), Positives = 29/59 (49%), Gaps = 5/59 (8%) Frame = +3 Query: 78 CPSLAVCNVPVANEACCRGINDVIKTKNCACVLP-----DHRVIANNCSENWCPKCRCC 239 CPSL C AN CC+ I+D IK+ C+CV H + C WCPKC C Sbjct: 70 CPSLDACRGGKANSGCCKKISDAIKSDGCSCVCKILKSYSHPSLPATCYSGWCPKCSNC 128