BLASTX nr result
ID: Magnolia22_contig00005833
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Magnolia22_contig00005833 (513 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_006428345.1 hypothetical protein CICLE_v10013710mg, partial [... 84 3e-18 OAY42463.1 hypothetical protein MANES_09G181700 [Manihot esculenta] 82 1e-17 XP_008776670.1 PREDICTED: hydrophobic protein LTI6B [Phoenix dac... 82 1e-17 XP_004494506.1 PREDICTED: hydrophobic protein LTI6B-like [Cicer ... 81 2e-17 GAU11402.1 hypothetical protein TSUD_343930 [Trifolium subterran... 81 2e-17 XP_006428346.1 hypothetical protein CICLE_v10013304mg [Citrus cl... 81 2e-17 ACA66247.1 cold-induced plasma membrane protein [Musa ABB Group] 80 3e-17 XP_018676027.1 PREDICTED: hydrophobic protein LTI6B-like [Musa a... 80 3e-17 KGN65991.1 hypothetical protein Csa_1G560745 [Cucumis sativus] 80 3e-17 APX54930.1 transmembrane protein 1 [Aeluropus littoralis] 80 4e-17 XP_018856461.1 PREDICTED: hydrophobic protein RCI2B-like [Juglan... 80 4e-17 XP_010271058.1 PREDICTED: hydrophobic protein RCI2B [Nelumbo nuc... 79 9e-17 XP_012088816.1 PREDICTED: hydrophobic protein LTI6B-like [Jatrop... 79 2e-16 KCW44804.1 hypothetical protein EUGRSUZ_L01633, partial [Eucalyp... 80 2e-16 XP_020108062.1 hydrophobic protein LTI6A [Ananas comosus] 78 3e-16 XP_019058815.1 PREDICTED: hydrophobic protein RCI2B [Tarenaya ha... 78 3e-16 XP_006480341.1 PREDICTED: hydrophobic protein RCI2B [Citrus sine... 78 3e-16 XP_019702864.1 PREDICTED: hydrophobic protein RCI2B-like [Elaeis... 78 3e-16 XP_009412350.2 PREDICTED: uncharacterized protein LOC103993862 [... 80 3e-16 ADC45381.1 stress-induced hydrophobic peptide [Cleistogenes song... 78 4e-16 >XP_006428345.1 hypothetical protein CICLE_v10013710mg, partial [Citrus clementina] ESR41585.1 hypothetical protein CICLE_v10013710mg, partial [Citrus clementina] Length = 104 Score = 84.3 bits (207), Expect = 3e-18 Identities = 39/53 (73%), Positives = 44/53 (83%) Frame = -3 Query: 499 ISLYSSLFQELSSMADEGTANCVDILLAILLPPLGVFLKFGCKAEFWICLLLT 341 I + +LF+ S MAD TA CVDILLA++LPPLGVFLKFGCKAEFWICLLLT Sbjct: 34 ILFHFTLFKNQSKMADGSTATCVDILLAVILPPLGVFLKFGCKAEFWICLLLT 86 >OAY42463.1 hypothetical protein MANES_09G181700 [Manihot esculenta] Length = 57 Score = 81.6 bits (200), Expect = 1e-17 Identities = 36/40 (90%), Positives = 39/40 (97%) Frame = -3 Query: 460 MADEGTANCVDILLAILLPPLGVFLKFGCKAEFWICLLLT 341 MADEGTA C+DILLAILLPPLGVFLK+GCKAEFWICL+LT Sbjct: 1 MADEGTATCIDILLAILLPPLGVFLKYGCKAEFWICLVLT 40 >XP_008776670.1 PREDICTED: hydrophobic protein LTI6B [Phoenix dactylifera] XP_008776671.1 PREDICTED: hydrophobic protein LTI6B [Phoenix dactylifera] Length = 57 Score = 81.6 bits (200), Expect = 1e-17 Identities = 36/40 (90%), Positives = 39/40 (97%) Frame = -3 Query: 460 MADEGTANCVDILLAILLPPLGVFLKFGCKAEFWICLLLT 341 MADEGTA C+DIL+AI+LPPLGVFLKFGCKAEFWICLLLT Sbjct: 1 MADEGTATCLDILIAIILPPLGVFLKFGCKAEFWICLLLT 40 >XP_004494506.1 PREDICTED: hydrophobic protein LTI6B-like [Cicer arietinum] Length = 57 Score = 81.3 bits (199), Expect = 2e-17 Identities = 36/40 (90%), Positives = 38/40 (95%) Frame = -3 Query: 460 MADEGTANCVDILLAILLPPLGVFLKFGCKAEFWICLLLT 341 MADEGTANC+DILLAILLPPLGVFLKFGC EFWICL+LT Sbjct: 1 MADEGTANCIDILLAILLPPLGVFLKFGCHVEFWICLVLT 40 >GAU11402.1 hypothetical protein TSUD_343930 [Trifolium subterraneum] Length = 57 Score = 80.9 bits (198), Expect = 2e-17 Identities = 35/40 (87%), Positives = 38/40 (95%) Frame = -3 Query: 460 MADEGTANCVDILLAILLPPLGVFLKFGCKAEFWICLLLT 341 MADEGTANC+DILLAI+LPPLGVFLKFGC EFWICL+LT Sbjct: 1 MADEGTANCIDILLAIILPPLGVFLKFGCNVEFWICLVLT 40 >XP_006428346.1 hypothetical protein CICLE_v10013304mg [Citrus clementina] XP_006428347.1 hypothetical protein CICLE_v10013304mg [Citrus clementina] XP_006480340.1 PREDICTED: hydrophobic protein RCI2B [Citrus sinensis] ESR41586.1 hypothetical protein CICLE_v10013304mg [Citrus clementina] ESR41587.1 hypothetical protein CICLE_v10013304mg [Citrus clementina] KDO56401.1 hypothetical protein CISIN_1g035460mg [Citrus sinensis] KDO56402.1 hypothetical protein CISIN_1g035460mg [Citrus sinensis] Length = 58 Score = 80.9 bits (198), Expect = 2e-17 Identities = 35/40 (87%), Positives = 38/40 (95%) Frame = -3 Query: 460 MADEGTANCVDILLAILLPPLGVFLKFGCKAEFWICLLLT 341 MADEGTA C+DI+LAI+LPPLGVFLKFGCK EFWICLLLT Sbjct: 1 MADEGTATCIDIILAIILPPLGVFLKFGCKVEFWICLLLT 40 >ACA66247.1 cold-induced plasma membrane protein [Musa ABB Group] Length = 57 Score = 80.5 bits (197), Expect = 3e-17 Identities = 35/40 (87%), Positives = 39/40 (97%) Frame = -3 Query: 460 MADEGTANCVDILLAILLPPLGVFLKFGCKAEFWICLLLT 341 MAD+GTANC+DILLAI+LPPLGVFLKFGC+ EFWICLLLT Sbjct: 1 MADKGTANCIDILLAIILPPLGVFLKFGCEMEFWICLLLT 40 >XP_018676027.1 PREDICTED: hydrophobic protein LTI6B-like [Musa acuminata subsp. malaccensis] Length = 57 Score = 80.5 bits (197), Expect = 3e-17 Identities = 35/40 (87%), Positives = 38/40 (95%) Frame = -3 Query: 460 MADEGTANCVDILLAILLPPLGVFLKFGCKAEFWICLLLT 341 MADEGT NC+DIL+AILLPPLGVFLKFGC+ EFWICLLLT Sbjct: 1 MADEGTVNCIDILVAILLPPLGVFLKFGCQVEFWICLLLT 40 >KGN65991.1 hypothetical protein Csa_1G560745 [Cucumis sativus] Length = 57 Score = 80.5 bits (197), Expect = 3e-17 Identities = 35/40 (87%), Positives = 38/40 (95%) Frame = -3 Query: 460 MADEGTANCVDILLAILLPPLGVFLKFGCKAEFWICLLLT 341 MADEGT NC+DILLAILLPPLGVFLKFGC+ EFWICL+LT Sbjct: 1 MADEGTTNCIDILLAILLPPLGVFLKFGCQVEFWICLVLT 40 >APX54930.1 transmembrane protein 1 [Aeluropus littoralis] Length = 57 Score = 80.1 bits (196), Expect = 4e-17 Identities = 36/40 (90%), Positives = 38/40 (95%) Frame = -3 Query: 460 MADEGTANCVDILLAILLPPLGVFLKFGCKAEFWICLLLT 341 MADEGTANCVDIL+AI+LPPLGVFLKFGC EFWICLLLT Sbjct: 1 MADEGTANCVDILIAIILPPLGVFLKFGCGHEFWICLLLT 40 >XP_018856461.1 PREDICTED: hydrophobic protein RCI2B-like [Juglans regia] Length = 57 Score = 80.1 bits (196), Expect = 4e-17 Identities = 35/40 (87%), Positives = 38/40 (95%) Frame = -3 Query: 460 MADEGTANCVDILLAILLPPLGVFLKFGCKAEFWICLLLT 341 MADEGTA C+DILLAI+LPPLGVFLKFGC+ EFWICLLLT Sbjct: 1 MADEGTATCIDILLAIILPPLGVFLKFGCQVEFWICLLLT 40 >XP_010271058.1 PREDICTED: hydrophobic protein RCI2B [Nelumbo nucifera] Length = 57 Score = 79.3 bits (194), Expect = 9e-17 Identities = 35/40 (87%), Positives = 37/40 (92%) Frame = -3 Query: 460 MADEGTANCVDILLAILLPPLGVFLKFGCKAEFWICLLLT 341 MA EGTA C+DILLAI+LPPLGVFLKFGCK EFWICLLLT Sbjct: 1 MASEGTATCIDILLAIILPPLGVFLKFGCKVEFWICLLLT 40 >XP_012088816.1 PREDICTED: hydrophobic protein LTI6B-like [Jatropha curcas] ACV50425.1 cold induced plasma membrane protein [Jatropha curcas] KDP23328.1 hypothetical protein JCGZ_23161 [Jatropha curcas] Length = 57 Score = 78.6 bits (192), Expect = 2e-16 Identities = 34/40 (85%), Positives = 37/40 (92%) Frame = -3 Query: 460 MADEGTANCVDILLAILLPPLGVFLKFGCKAEFWICLLLT 341 M EGTA C+DILLA++LPPLGVFLKFGCKAEFWICLLLT Sbjct: 1 MPSEGTATCIDILLAVILPPLGVFLKFGCKAEFWICLLLT 40 >KCW44804.1 hypothetical protein EUGRSUZ_L01633, partial [Eucalyptus grandis] Length = 117 Score = 80.1 bits (196), Expect = 2e-16 Identities = 37/56 (66%), Positives = 47/56 (83%), Gaps = 2/56 (3%) Frame = -3 Query: 502 LISLYSSLFQELSS--MADEGTANCVDILLAILLPPLGVFLKFGCKAEFWICLLLT 341 + S ++S+ +E + MADEGT NC+DILLAI+LPPLGVFLKFGC+ EFWICL+LT Sbjct: 45 ICSTFTSVKREKGTGKMADEGTMNCIDILLAIILPPLGVFLKFGCQVEFWICLVLT 100 >XP_020108062.1 hydrophobic protein LTI6A [Ananas comosus] Length = 57 Score = 78.2 bits (191), Expect = 3e-16 Identities = 34/40 (85%), Positives = 37/40 (92%) Frame = -3 Query: 460 MADEGTANCVDILLAILLPPLGVFLKFGCKAEFWICLLLT 341 MAD+ TA C+DILLAI+LPPLGVFLKFGCK EFWICLLLT Sbjct: 1 MADDSTATCIDILLAIILPPLGVFLKFGCKVEFWICLLLT 40 >XP_019058815.1 PREDICTED: hydrophobic protein RCI2B [Tarenaya hassleriana] XP_019058816.1 PREDICTED: hydrophobic protein RCI2B [Tarenaya hassleriana] Length = 58 Score = 78.2 bits (191), Expect = 3e-16 Identities = 36/40 (90%), Positives = 37/40 (92%) Frame = -3 Query: 460 MADEGTANCVDILLAILLPPLGVFLKFGCKAEFWICLLLT 341 MAD TA CVDILLAILLPPLGVFLKFGCKAEFWICL+LT Sbjct: 1 MADGSTATCVDILLAILLPPLGVFLKFGCKAEFWICLVLT 40 >XP_006480341.1 PREDICTED: hydrophobic protein RCI2B [Citrus sinensis] XP_006480342.1 PREDICTED: hydrophobic protein RCI2B [Citrus sinensis] KDO56403.1 hypothetical protein CISIN_1g035437mg [Citrus sinensis] KDO56404.1 hypothetical protein CISIN_1g035437mg [Citrus sinensis] Length = 58 Score = 78.2 bits (191), Expect = 3e-16 Identities = 35/40 (87%), Positives = 37/40 (92%) Frame = -3 Query: 460 MADEGTANCVDILLAILLPPLGVFLKFGCKAEFWICLLLT 341 MAD TA CVDILLA++LPPLGVFLKFGCKAEFWICLLLT Sbjct: 1 MADGSTATCVDILLAVILPPLGVFLKFGCKAEFWICLLLT 40 >XP_019702864.1 PREDICTED: hydrophobic protein RCI2B-like [Elaeis guineensis] Length = 59 Score = 78.2 bits (191), Expect = 3e-16 Identities = 33/40 (82%), Positives = 37/40 (92%) Frame = -3 Query: 460 MADEGTANCVDILLAILLPPLGVFLKFGCKAEFWICLLLT 341 MADEGT C+DIL+AI+LPPLGVFLKFGCK EFWICL+LT Sbjct: 1 MADEGTVTCIDILIAIILPPLGVFLKFGCKVEFWICLVLT 40 >XP_009412350.2 PREDICTED: uncharacterized protein LOC103993862 [Musa acuminata subsp. malaccensis] Length = 133 Score = 80.1 bits (196), Expect = 3e-16 Identities = 35/42 (83%), Positives = 40/42 (95%) Frame = -3 Query: 466 SSMADEGTANCVDILLAILLPPLGVFLKFGCKAEFWICLLLT 341 SSMA++GTA C++ILLAI+LPPLGVFLKFGCK EFWICLLLT Sbjct: 75 SSMANQGTARCIEILLAIILPPLGVFLKFGCKVEFWICLLLT 116 >ADC45381.1 stress-induced hydrophobic peptide [Cleistogenes songorica] Length = 57 Score = 77.8 bits (190), Expect = 4e-16 Identities = 34/40 (85%), Positives = 38/40 (95%) Frame = -3 Query: 460 MADEGTANCVDILLAILLPPLGVFLKFGCKAEFWICLLLT 341 MADEGTA+C+DIL+AI+LPPLGVFLKFGC EFWICLLLT Sbjct: 1 MADEGTASCIDILIAIILPPLGVFLKFGCGHEFWICLLLT 40