BLASTX nr result
ID: Magnolia22_contig00003007
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Magnolia22_contig00003007 (540 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_008337213.1 PREDICTED: 116 kDa U5 small nuclear ribonucleopro... 81 1e-16 XP_016447827.1 PREDICTED: 116 kDa U5 small nuclear ribonucleopro... 78 3e-15 BAJ96337.1 predicted protein, partial [Hordeum vulgare subsp. vu... 81 1e-14 BAS98551.1 Os06g0608300, partial [Oryza sativa Japonica Group] 81 1e-14 ONK68357.1 uncharacterized protein A4U43_C05F10570 [Asparagus of... 81 1e-14 KHN47136.1 116 kDa U5 small nuclear ribonucleoprotein component ... 81 1e-14 XP_010099513.1 116 kDa U5 small nuclear ribonucleoprotein compon... 81 1e-14 CBI25589.3 unnamed protein product, partial [Vitis vinifera] 81 1e-14 EMT00518.1 116 kDa U5 small nuclear ribonucleoprotein component ... 81 1e-14 XP_020109363.1 110 kDa U5 small nuclear ribonucleoprotein compon... 81 1e-14 KHN18601.1 116 kDa U5 small nuclear ribonucleoprotein component ... 81 2e-14 XP_002309312.2 elongation factor Tu family protein [Populus tric... 81 2e-14 EEE65993.1 hypothetical protein OsJ_21930 [Oryza sativa Japonica... 81 2e-14 XP_014509398.1 PREDICTED: 116 kDa U5 small nuclear ribonucleopro... 81 2e-14 XP_010542071.1 PREDICTED: 110 kDa U5 small nuclear ribonucleopro... 81 2e-14 XP_017441523.1 PREDICTED: 110 kDa U5 small nuclear ribonucleopro... 81 2e-14 XP_007155109.1 hypothetical protein PHAVU_003G174100g [Phaseolus... 81 2e-14 XP_003542669.1 PREDICTED: 116 kDa U5 small nuclear ribonucleopro... 81 2e-14 GAV85988.1 GTP_EFTU domain-containing protein/EFG_C domain-conta... 81 2e-14 XP_019242520.1 PREDICTED: 110 kDa U5 small nuclear ribonucleopro... 81 2e-14 >XP_008337213.1 PREDICTED: 116 kDa U5 small nuclear ribonucleoprotein component-like [Malus domestica] Length = 105 Score = 80.9 bits (198), Expect = 1e-16 Identities = 39/39 (100%), Positives = 39/39 (100%) Frame = -3 Query: 538 IVLRPLEPAPIQHLAREFMVKTRRRKGMSEDVSINKFFD 422 IVLRPLEPAPIQHLAREFMVKTRRRKGMSEDVSINKFFD Sbjct: 48 IVLRPLEPAPIQHLAREFMVKTRRRKGMSEDVSINKFFD 86 >XP_016447827.1 PREDICTED: 116 kDa U5 small nuclear ribonucleoprotein component-like [Nicotiana tabacum] XP_016447828.1 PREDICTED: 116 kDa U5 small nuclear ribonucleoprotein component-like [Nicotiana tabacum] Length = 134 Score = 77.8 bits (190), Expect = 3e-15 Identities = 37/39 (94%), Positives = 38/39 (97%) Frame = -3 Query: 538 IVLRPLEPAPIQHLAREFMVKTRRRKGMSEDVSINKFFD 422 IVLRPLEPAPIQHLAREFMVKTRRRKGMSEDV+IN FFD Sbjct: 77 IVLRPLEPAPIQHLAREFMVKTRRRKGMSEDVTINNFFD 115 >BAJ96337.1 predicted protein, partial [Hordeum vulgare subsp. vulgare] Length = 452 Score = 80.9 bits (198), Expect = 1e-14 Identities = 39/39 (100%), Positives = 39/39 (100%) Frame = -3 Query: 538 IVLRPLEPAPIQHLAREFMVKTRRRKGMSEDVSINKFFD 422 IVLRPLEPAPIQHLAREFMVKTRRRKGMSEDVSINKFFD Sbjct: 396 IVLRPLEPAPIQHLAREFMVKTRRRKGMSEDVSINKFFD 434 >BAS98551.1 Os06g0608300, partial [Oryza sativa Japonica Group] Length = 556 Score = 80.9 bits (198), Expect = 1e-14 Identities = 39/39 (100%), Positives = 39/39 (100%) Frame = -3 Query: 538 IVLRPLEPAPIQHLAREFMVKTRRRKGMSEDVSINKFFD 422 IVLRPLEPAPIQHLAREFMVKTRRRKGMSEDVSINKFFD Sbjct: 499 IVLRPLEPAPIQHLAREFMVKTRRRKGMSEDVSINKFFD 537 >ONK68357.1 uncharacterized protein A4U43_C05F10570 [Asparagus officinalis] Length = 895 Score = 80.9 bits (198), Expect = 1e-14 Identities = 39/39 (100%), Positives = 39/39 (100%) Frame = -3 Query: 538 IVLRPLEPAPIQHLAREFMVKTRRRKGMSEDVSINKFFD 422 IVLRPLEPAPIQHLAREFMVKTRRRKGMSEDVSINKFFD Sbjct: 838 IVLRPLEPAPIQHLAREFMVKTRRRKGMSEDVSINKFFD 876 >KHN47136.1 116 kDa U5 small nuclear ribonucleoprotein component [Glycine soja] Length = 919 Score = 80.9 bits (198), Expect = 1e-14 Identities = 39/39 (100%), Positives = 39/39 (100%) Frame = -3 Query: 538 IVLRPLEPAPIQHLAREFMVKTRRRKGMSEDVSINKFFD 422 IVLRPLEPAPIQHLAREFMVKTRRRKGMSEDVSINKFFD Sbjct: 862 IVLRPLEPAPIQHLAREFMVKTRRRKGMSEDVSINKFFD 900 >XP_010099513.1 116 kDa U5 small nuclear ribonucleoprotein component [Morus notabilis] EXB79364.1 116 kDa U5 small nuclear ribonucleoprotein component [Morus notabilis] Length = 925 Score = 80.9 bits (198), Expect = 1e-14 Identities = 39/39 (100%), Positives = 39/39 (100%) Frame = -3 Query: 538 IVLRPLEPAPIQHLAREFMVKTRRRKGMSEDVSINKFFD 422 IVLRPLEPAPIQHLAREFMVKTRRRKGMSEDVSINKFFD Sbjct: 868 IVLRPLEPAPIQHLAREFMVKTRRRKGMSEDVSINKFFD 906 >CBI25589.3 unnamed protein product, partial [Vitis vinifera] Length = 931 Score = 80.9 bits (198), Expect = 1e-14 Identities = 39/39 (100%), Positives = 39/39 (100%) Frame = -3 Query: 538 IVLRPLEPAPIQHLAREFMVKTRRRKGMSEDVSINKFFD 422 IVLRPLEPAPIQHLAREFMVKTRRRKGMSEDVSINKFFD Sbjct: 874 IVLRPLEPAPIQHLAREFMVKTRRRKGMSEDVSINKFFD 912 >EMT00518.1 116 kDa U5 small nuclear ribonucleoprotein component [Aegilops tauschii] Length = 942 Score = 80.9 bits (198), Expect = 1e-14 Identities = 39/39 (100%), Positives = 39/39 (100%) Frame = -3 Query: 538 IVLRPLEPAPIQHLAREFMVKTRRRKGMSEDVSINKFFD 422 IVLRPLEPAPIQHLAREFMVKTRRRKGMSEDVSINKFFD Sbjct: 886 IVLRPLEPAPIQHLAREFMVKTRRRKGMSEDVSINKFFD 924 >XP_020109363.1 110 kDa U5 small nuclear ribonucleoprotein component CLO-like isoform X1 [Ananas comosus] XP_020109364.1 110 kDa U5 small nuclear ribonucleoprotein component CLO-like isoform X1 [Ananas comosus] Length = 958 Score = 80.9 bits (198), Expect = 1e-14 Identities = 39/39 (100%), Positives = 39/39 (100%) Frame = -3 Query: 538 IVLRPLEPAPIQHLAREFMVKTRRRKGMSEDVSINKFFD 422 IVLRPLEPAPIQHLAREFMVKTRRRKGMSEDVSINKFFD Sbjct: 901 IVLRPLEPAPIQHLAREFMVKTRRRKGMSEDVSINKFFD 939 >KHN18601.1 116 kDa U5 small nuclear ribonucleoprotein component [Glycine soja] Length = 969 Score = 80.9 bits (198), Expect = 2e-14 Identities = 39/39 (100%), Positives = 39/39 (100%) Frame = -3 Query: 538 IVLRPLEPAPIQHLAREFMVKTRRRKGMSEDVSINKFFD 422 IVLRPLEPAPIQHLAREFMVKTRRRKGMSEDVSINKFFD Sbjct: 912 IVLRPLEPAPIQHLAREFMVKTRRRKGMSEDVSINKFFD 950 >XP_002309312.2 elongation factor Tu family protein [Populus trichocarpa] EEE92835.2 elongation factor Tu family protein [Populus trichocarpa] Length = 969 Score = 80.9 bits (198), Expect = 2e-14 Identities = 39/39 (100%), Positives = 39/39 (100%) Frame = -3 Query: 538 IVLRPLEPAPIQHLAREFMVKTRRRKGMSEDVSINKFFD 422 IVLRPLEPAPIQHLAREFMVKTRRRKGMSEDVSINKFFD Sbjct: 913 IVLRPLEPAPIQHLAREFMVKTRRRKGMSEDVSINKFFD 951 >EEE65993.1 hypothetical protein OsJ_21930 [Oryza sativa Japonica Group] Length = 977 Score = 80.9 bits (198), Expect = 2e-14 Identities = 39/39 (100%), Positives = 39/39 (100%) Frame = -3 Query: 538 IVLRPLEPAPIQHLAREFMVKTRRRKGMSEDVSINKFFD 422 IVLRPLEPAPIQHLAREFMVKTRRRKGMSEDVSINKFFD Sbjct: 920 IVLRPLEPAPIQHLAREFMVKTRRRKGMSEDVSINKFFD 958 >XP_014509398.1 PREDICTED: 116 kDa U5 small nuclear ribonucleoprotein component-like [Vigna radiata var. radiata] Length = 985 Score = 80.9 bits (198), Expect = 2e-14 Identities = 39/39 (100%), Positives = 39/39 (100%) Frame = -3 Query: 538 IVLRPLEPAPIQHLAREFMVKTRRRKGMSEDVSINKFFD 422 IVLRPLEPAPIQHLAREFMVKTRRRKGMSEDVSINKFFD Sbjct: 928 IVLRPLEPAPIQHLAREFMVKTRRRKGMSEDVSINKFFD 966 >XP_010542071.1 PREDICTED: 110 kDa U5 small nuclear ribonucleoprotein component CLO [Tarenaya hassleriana] XP_010542072.1 PREDICTED: 110 kDa U5 small nuclear ribonucleoprotein component CLO [Tarenaya hassleriana] XP_010542073.1 PREDICTED: 110 kDa U5 small nuclear ribonucleoprotein component CLO [Tarenaya hassleriana] XP_010542074.1 PREDICTED: 110 kDa U5 small nuclear ribonucleoprotein component CLO [Tarenaya hassleriana] Length = 985 Score = 80.9 bits (198), Expect = 2e-14 Identities = 39/39 (100%), Positives = 39/39 (100%) Frame = -3 Query: 538 IVLRPLEPAPIQHLAREFMVKTRRRKGMSEDVSINKFFD 422 IVLRPLEPAPIQHLAREFMVKTRRRKGMSEDVSINKFFD Sbjct: 930 IVLRPLEPAPIQHLAREFMVKTRRRKGMSEDVSINKFFD 968 >XP_017441523.1 PREDICTED: 110 kDa U5 small nuclear ribonucleoprotein component CLO [Vigna angularis] KOM32942.1 hypothetical protein LR48_Vigan01g249800 [Vigna angularis] BAT76248.1 hypothetical protein VIGAN_01422400 [Vigna angularis var. angularis] Length = 986 Score = 80.9 bits (198), Expect = 2e-14 Identities = 39/39 (100%), Positives = 39/39 (100%) Frame = -3 Query: 538 IVLRPLEPAPIQHLAREFMVKTRRRKGMSEDVSINKFFD 422 IVLRPLEPAPIQHLAREFMVKTRRRKGMSEDVSINKFFD Sbjct: 929 IVLRPLEPAPIQHLAREFMVKTRRRKGMSEDVSINKFFD 967 >XP_007155109.1 hypothetical protein PHAVU_003G174100g [Phaseolus vulgaris] ESW27103.1 hypothetical protein PHAVU_003G174100g [Phaseolus vulgaris] Length = 986 Score = 80.9 bits (198), Expect = 2e-14 Identities = 39/39 (100%), Positives = 39/39 (100%) Frame = -3 Query: 538 IVLRPLEPAPIQHLAREFMVKTRRRKGMSEDVSINKFFD 422 IVLRPLEPAPIQHLAREFMVKTRRRKGMSEDVSINKFFD Sbjct: 929 IVLRPLEPAPIQHLAREFMVKTRRRKGMSEDVSINKFFD 967 >XP_003542669.1 PREDICTED: 116 kDa U5 small nuclear ribonucleoprotein component-like [Glycine max] KRH20245.1 hypothetical protein GLYMA_13G165400 [Glycine max] Length = 986 Score = 80.9 bits (198), Expect = 2e-14 Identities = 39/39 (100%), Positives = 39/39 (100%) Frame = -3 Query: 538 IVLRPLEPAPIQHLAREFMVKTRRRKGMSEDVSINKFFD 422 IVLRPLEPAPIQHLAREFMVKTRRRKGMSEDVSINKFFD Sbjct: 929 IVLRPLEPAPIQHLAREFMVKTRRRKGMSEDVSINKFFD 967 >GAV85988.1 GTP_EFTU domain-containing protein/EFG_C domain-containing protein/GTP_EFTU_D2 domain-containing protein/EFG_IV domain-containing protein [Cephalotus follicularis] Length = 987 Score = 80.9 bits (198), Expect = 2e-14 Identities = 39/39 (100%), Positives = 39/39 (100%) Frame = -3 Query: 538 IVLRPLEPAPIQHLAREFMVKTRRRKGMSEDVSINKFFD 422 IVLRPLEPAPIQHLAREFMVKTRRRKGMSEDVSINKFFD Sbjct: 930 IVLRPLEPAPIQHLAREFMVKTRRRKGMSEDVSINKFFD 968 >XP_019242520.1 PREDICTED: 110 kDa U5 small nuclear ribonucleoprotein component CLO [Nicotiana attenuata] Length = 987 Score = 80.9 bits (198), Expect = 2e-14 Identities = 39/39 (100%), Positives = 39/39 (100%) Frame = -3 Query: 538 IVLRPLEPAPIQHLAREFMVKTRRRKGMSEDVSINKFFD 422 IVLRPLEPAPIQHLAREFMVKTRRRKGMSEDVSINKFFD Sbjct: 930 IVLRPLEPAPIQHLAREFMVKTRRRKGMSEDVSINKFFD 968