BLASTX nr result
ID: Magnolia22_contig00002991
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Magnolia22_contig00002991 (1430 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_015890196.1 PREDICTED: pentatricopeptide repeat-containing pr... 100 3e-21 XP_007046988.2 PREDICTED: pentatricopeptide repeat-containing pr... 98 3e-21 EOX91145.1 Tetratricopeptide repeat (TPR)-like superfamily prote... 98 3e-21 KDO79503.1 hypothetical protein CISIN_1g015673mg [Citrus sinensis] 100 7e-21 XP_006425713.1 hypothetical protein CICLE_v10025762mg [Citrus cl... 100 7e-21 XP_019230683.1 PREDICTED: pentatricopeptide repeat-containing pr... 100 5e-20 XP_016442680.1 PREDICTED: pentatricopeptide repeat-containing pr... 100 6e-20 XP_009626271.1 PREDICTED: pentatricopeptide repeat-containing pr... 99 8e-20 CAN68320.1 hypothetical protein VITISV_032192 [Vitis vinifera] 98 3e-19 XP_008777843.1 PREDICTED: pentatricopeptide repeat-containing pr... 100 3e-19 XP_002271426.1 PREDICTED: pentatricopeptide repeat-containing pr... 96 9e-19 XP_016459374.1 PREDICTED: pentatricopeptide repeat-containing pr... 97 9e-19 XP_009795026.1 PREDICTED: pentatricopeptide repeat-containing pr... 97 9e-19 XP_016459386.1 PREDICTED: pentatricopeptide repeat-containing pr... 97 9e-19 CBI17546.3 unnamed protein product, partial [Vitis vinifera] 96 9e-19 XP_010277336.1 PREDICTED: pentatricopeptide repeat-containing pr... 98 1e-18 XP_006363148.1 PREDICTED: pentatricopeptide repeat-containing pr... 98 2e-18 XP_016735240.1 PREDICTED: pentatricopeptide repeat-containing pr... 95 2e-18 XP_012436918.1 PREDICTED: pentatricopeptide repeat-containing pr... 95 2e-18 XP_019173173.1 PREDICTED: pentatricopeptide repeat-containing pr... 97 2e-18 >XP_015890196.1 PREDICTED: pentatricopeptide repeat-containing protein At4g36680, mitochondrial [Ziziphus jujuba] Length = 412 Score = 100 bits (249), Expect(2) = 3e-21 Identities = 51/92 (55%), Positives = 62/92 (67%), Gaps = 9/92 (9%) Frame = -1 Query: 1391 PQEVLGLMDEMASSGLKPDTISYNYLMTCYCKNGKMDEAKKVY*GLEEKRCLPNATT--- 1221 P++V L+DEM+++GLKPDTISYNYLMTCYCKNG M+EAK VY GLE+ C PNA T Sbjct: 258 PEKVKALIDEMSNAGLKPDTISYNYLMTCYCKNGMMEEAKNVYEGLEDNGCNPNAATFRT 317 Query: 1220 ------*EWGFQCGVGIFKASVKKSKIPNFGT 1143 F+ G +FK SV KIP+F T Sbjct: 318 LIYYLCRSGDFERGYKVFKTSVGVHKIPDFNT 349 Score = 31.2 bits (69), Expect(2) = 3e-21 Identities = 15/26 (57%), Positives = 19/26 (73%) Frame = -3 Query: 1140 KGLVEGLVKNSKVVKAKGSI*EVKKR 1063 K LVEGLVK K+ +AKG I +KK+ Sbjct: 351 KHLVEGLVKKKKIKEAKGLIRTIKKK 376 >XP_007046988.2 PREDICTED: pentatricopeptide repeat-containing protein At4g36680, mitochondrial [Theobroma cacao] Length = 411 Score = 97.8 bits (242), Expect(2) = 3e-21 Identities = 52/92 (56%), Positives = 62/92 (67%), Gaps = 9/92 (9%) Frame = -1 Query: 1391 PQEVLGLMDEMASSGLKPDTISYNYLMTCYCKNGKMDEAKKVY*GLEEKRCLPNATT*EW 1212 P++V L+DEM++ GLKPDTISYNYLMTCYCKNG +DEAKKVY GLE C PNA T Sbjct: 257 PEKVKELIDEMSTMGLKPDTISYNYLMTCYCKNGMLDEAKKVYEGLEGNGCNPNAATFRT 316 Query: 1211 --GFQC-------GVGIFKASVKKSKIPNFGT 1143 + C G +FK SV+ KIP+F T Sbjct: 317 LVFYLCLNGLHEQGYKVFKESVRLHKIPDFNT 348 Score = 33.9 bits (76), Expect(2) = 3e-21 Identities = 17/26 (65%), Positives = 20/26 (76%) Frame = -3 Query: 1140 KGLVEGLVKNSKVVKAKGSI*EVKKR 1063 K LVEGLVKN K+ +AKG I VKK+ Sbjct: 350 KHLVEGLVKNKKIKEAKGLIRTVKKK 375 >EOX91145.1 Tetratricopeptide repeat (TPR)-like superfamily protein [Theobroma cacao] Length = 411 Score = 97.8 bits (242), Expect(2) = 3e-21 Identities = 52/92 (56%), Positives = 62/92 (67%), Gaps = 9/92 (9%) Frame = -1 Query: 1391 PQEVLGLMDEMASSGLKPDTISYNYLMTCYCKNGKMDEAKKVY*GLEEKRCLPNATT*EW 1212 P++V L+DEM++ GLKPDTISYNYLMTCYCKNG +DEAKKVY GLE C PNA T Sbjct: 257 PEKVKELIDEMSTMGLKPDTISYNYLMTCYCKNGMLDEAKKVYEGLEGNGCNPNAATFRT 316 Query: 1211 --GFQC-------GVGIFKASVKKSKIPNFGT 1143 + C G +FK SV+ KIP+F T Sbjct: 317 LVFYLCLNGLHEQGYKVFKESVRLHKIPDFNT 348 Score = 33.9 bits (76), Expect(2) = 3e-21 Identities = 17/26 (65%), Positives = 20/26 (76%) Frame = -3 Query: 1140 KGLVEGLVKNSKVVKAKGSI*EVKKR 1063 K LVEGLVKN K+ +AKG I VKK+ Sbjct: 350 KHLVEGLVKNKKIKEAKGLIRTVKKK 375 >KDO79503.1 hypothetical protein CISIN_1g015673mg [Citrus sinensis] Length = 403 Score = 100 bits (248), Expect(2) = 7e-21 Identities = 54/92 (58%), Positives = 62/92 (67%), Gaps = 9/92 (9%) Frame = -1 Query: 1391 PQEVLGLMDEMASSGLKPDTISYNYLMTCYCKNGKMDEAKKVY*GLEEKRCLPNATT*E- 1215 P+ + L+DEM +GLKPDTISYN+LMTCYCKN MDEAKKVY GLEE C PNATT Sbjct: 253 PERLKELIDEMRDAGLKPDTISYNFLMTCYCKNEMMDEAKKVYEGLEENGCSPNATTFRT 312 Query: 1214 WGFQ-CGVG-------IFKASVKKSKIPNFGT 1143 W + CG G +FK SV KIP+F T Sbjct: 313 WIYHLCGSGNFDKAYKVFKESVMVHKIPDFNT 344 Score = 30.4 bits (67), Expect(2) = 7e-21 Identities = 15/26 (57%), Positives = 19/26 (73%) Frame = -3 Query: 1140 KGLVEGLVKNSKVVKAKGSI*EVKKR 1063 K LVEGLVK K+ +AKG I +KK+ Sbjct: 346 KLLVEGLVKKKKIKEAKGVIRTIKKK 371 >XP_006425713.1 hypothetical protein CICLE_v10025762mg [Citrus clementina] XP_006466769.1 PREDICTED: pentatricopeptide repeat-containing protein At4g36680, mitochondrial [Citrus sinensis] ESR38953.1 hypothetical protein CICLE_v10025762mg [Citrus clementina] Length = 403 Score = 100 bits (248), Expect(2) = 7e-21 Identities = 54/92 (58%), Positives = 62/92 (67%), Gaps = 9/92 (9%) Frame = -1 Query: 1391 PQEVLGLMDEMASSGLKPDTISYNYLMTCYCKNGKMDEAKKVY*GLEEKRCLPNATT*E- 1215 P+ + L+DEM +GLKPDTISYN+LMTCYCKN MDEAKKVY GLEE C PNATT Sbjct: 253 PERLKELIDEMRDAGLKPDTISYNFLMTCYCKNEMMDEAKKVYEGLEENGCSPNATTFRT 312 Query: 1214 WGFQ-CGVG-------IFKASVKKSKIPNFGT 1143 W + CG G +FK SV KIP+F T Sbjct: 313 WIYHLCGSGNFDKAYKVFKESVMVHKIPDFNT 344 Score = 30.4 bits (67), Expect(2) = 7e-21 Identities = 15/26 (57%), Positives = 19/26 (73%) Frame = -3 Query: 1140 KGLVEGLVKNSKVVKAKGSI*EVKKR 1063 K LVEGLVK K+ +AKG I +KK+ Sbjct: 346 KLLVEGLVKKKKIKEAKGVIRTIKKK 371 >XP_019230683.1 PREDICTED: pentatricopeptide repeat-containing protein At4g36680, mitochondrial-like [Nicotiana attenuata] OIT29259.1 pentatricopeptide repeat-containing protein, mitochondrial [Nicotiana attenuata] Length = 405 Score = 100 bits (248), Expect(2) = 5e-20 Identities = 51/92 (55%), Positives = 62/92 (67%), Gaps = 9/92 (9%) Frame = -1 Query: 1391 PQEVLGLMDEMASSGLKPDTISYNYLMTCYCKNGKMDEAKKVY*GLEEKRCLPNATT--- 1221 P+ V L++EM+ +GLKPDTISYNYLMTCYCKNG MDEA+KVY LE RC PNA T Sbjct: 255 PEGVKALIEEMSDAGLKPDTISYNYLMTCYCKNGLMDEAQKVYEDLESNRCNPNAATFRT 314 Query: 1220 ------*EWGFQCGVGIFKASVKKSKIPNFGT 1143 + F+ G +FK SV+ KIP+F T Sbjct: 315 LIFYLCKKGRFETGYKVFKESVRVHKIPDFST 346 Score = 27.7 bits (60), Expect(2) = 5e-20 Identities = 15/26 (57%), Positives = 18/26 (69%) Frame = -3 Query: 1140 KGLVEGLVKNSKVVKAKGSI*EVKKR 1063 K LVEGLV+ SK+ AKG VKK+ Sbjct: 348 KYLVEGLVQRSKLKDAKGMSRTVKKK 373 >XP_016442680.1 PREDICTED: pentatricopeptide repeat-containing protein At4g36680, mitochondrial-like [Nicotiana tabacum] Length = 409 Score = 99.8 bits (247), Expect(2) = 6e-20 Identities = 51/93 (54%), Positives = 63/93 (67%), Gaps = 9/93 (9%) Frame = -1 Query: 1394 SPQEVLGLMDEMASSGLKPDTISYNYLMTCYCKNGKMDEAKKVY*GLEEKRCLPNATT-- 1221 +P+ V L++EM+ +GLKPDTISYNYLMTCYCKNG MDEA+KVY LE K C PNA T Sbjct: 252 NPEGVKALIEEMSDAGLKPDTISYNYLMTCYCKNGLMDEAQKVYEDLESKGCNPNAATFR 311 Query: 1220 -------*EWGFQCGVGIFKASVKKSKIPNFGT 1143 + F+ G +FK SV+ KIP+F T Sbjct: 312 TLIFYLCKKGRFETGYTVFKESVRVHKIPDFST 344 Score = 27.7 bits (60), Expect(2) = 6e-20 Identities = 15/26 (57%), Positives = 18/26 (69%) Frame = -3 Query: 1140 KGLVEGLVKNSKVVKAKGSI*EVKKR 1063 K LVEGLV+ SK+ AKG VKK+ Sbjct: 346 KYLVEGLVQRSKLKDAKGMSRTVKKK 371 >XP_009626271.1 PREDICTED: pentatricopeptide repeat-containing protein At4g36680, mitochondrial-like [Nicotiana tomentosiformis] XP_009626272.1 PREDICTED: pentatricopeptide repeat-containing protein At4g36680, mitochondrial-like [Nicotiana tomentosiformis] Length = 409 Score = 99.4 bits (246), Expect(2) = 8e-20 Identities = 51/92 (55%), Positives = 62/92 (67%), Gaps = 9/92 (9%) Frame = -1 Query: 1391 PQEVLGLMDEMASSGLKPDTISYNYLMTCYCKNGKMDEAKKVY*GLEEKRCLPNATT--- 1221 P+ V L++EM+ +GLKPDTISYNYLMTCYCKNG MDEA+KVY LE K C PNA T Sbjct: 253 PEGVKALIEEMSDAGLKPDTISYNYLMTCYCKNGLMDEAQKVYEDLESKGCNPNAATFRT 312 Query: 1220 ------*EWGFQCGVGIFKASVKKSKIPNFGT 1143 + F+ G +FK SV+ KIP+F T Sbjct: 313 LIFYLCKKGRFETGYTVFKESVRVHKIPDFST 344 Score = 27.7 bits (60), Expect(2) = 8e-20 Identities = 15/26 (57%), Positives = 18/26 (69%) Frame = -3 Query: 1140 KGLVEGLVKNSKVVKAKGSI*EVKKR 1063 K LVEGLV+ SK+ AKG VKK+ Sbjct: 346 KYLVEGLVQRSKLKDAKGMSRTVKKK 371 >CAN68320.1 hypothetical protein VITISV_032192 [Vitis vinifera] Length = 416 Score = 97.8 bits (242), Expect(2) = 3e-19 Identities = 51/92 (55%), Positives = 61/92 (66%), Gaps = 9/92 (9%) Frame = -1 Query: 1391 PQEVLGLMDEMASSGLKPDTISYNYLMTCYCKNGKMDEAKKVY*GLEEKRCLPNATT--- 1221 P+ V L+DEM+++GLKPDTISYNYLMT YCK+G MDEAKKVY LEE C PNA T Sbjct: 263 PENVKALIDEMSNAGLKPDTISYNYLMTSYCKSGMMDEAKKVYAELEETGCHPNAATFRT 322 Query: 1220 ------*EWGFQCGVGIFKASVKKSKIPNFGT 1143 F+ G +FK S + KIP+FGT Sbjct: 323 LIYYLCRSGDFETGYKVFKQSAFRRKIPDFGT 354 Score = 27.3 bits (59), Expect(2) = 3e-19 Identities = 15/30 (50%), Positives = 19/30 (63%) Frame = -3 Query: 1155 EFWDDKGLVEGLVKNSKVVKAKGSI*EVKK 1066 +F + LVEGLV+ K +AKG I VKK Sbjct: 351 DFGTLRHLVEGLVQKKKTKEAKGLIRTVKK 380 >XP_008777843.1 PREDICTED: pentatricopeptide repeat-containing protein At4g36680, mitochondrial [Phoenix dactylifera] XP_017696220.1 PREDICTED: pentatricopeptide repeat-containing protein At4g36680, mitochondrial [Phoenix dactylifera] Length = 419 Score = 100 bits (248), Expect = 3e-19 Identities = 47/92 (51%), Positives = 68/92 (73%), Gaps = 9/92 (9%) Frame = -1 Query: 1391 PQEVLGLMDEMASSGLKPDTISYNYLMTCYCKNGKMDEAKKVY*GLEEKRCLPNATT*E- 1215 P+EVL L+ EM S+G+KPDTI+YNYL+TCYC +G+++EAKKVY GL +K C+PNATT + Sbjct: 270 PEEVLELIQEMESAGVKPDTITYNYLITCYCNDGQLEEAKKVYKGLRKKGCVPNATTFKI 329 Query: 1214 --------WGFQCGVGIFKASVKKSKIPNFGT 1143 + G+ +FK S+K++K+P+F T Sbjct: 330 LLARSCANGDIEAGLEVFKDSMKQNKVPDFRT 361 >XP_002271426.1 PREDICTED: pentatricopeptide repeat-containing protein At4g36680, mitochondrial [Vitis vinifera] Length = 414 Score = 96.3 bits (238), Expect(2) = 9e-19 Identities = 50/92 (54%), Positives = 61/92 (66%), Gaps = 9/92 (9%) Frame = -1 Query: 1391 PQEVLGLMDEMASSGLKPDTISYNYLMTCYCKNGKMDEAKKVY*GLEEKRCLPNATT--- 1221 P+ V L+DEM+++GLKPDTISYNYLMT YCK+G +DEAKKVY LEE C PNA T Sbjct: 261 PENVKALIDEMSNAGLKPDTISYNYLMTSYCKSGMVDEAKKVYAELEETGCHPNAATFRT 320 Query: 1220 ------*EWGFQCGVGIFKASVKKSKIPNFGT 1143 F+ G +FK S + KIP+FGT Sbjct: 321 LIYYLCRSGDFETGYKVFKQSAFRRKIPDFGT 352 Score = 27.3 bits (59), Expect(2) = 9e-19 Identities = 15/30 (50%), Positives = 19/30 (63%) Frame = -3 Query: 1155 EFWDDKGLVEGLVKNSKVVKAKGSI*EVKK 1066 +F + LVEGLV+ K +AKG I VKK Sbjct: 349 DFGTLRHLVEGLVQKKKTKEAKGLIRTVKK 378 >XP_016459374.1 PREDICTED: pentatricopeptide repeat-containing protein At4g36680, mitochondrial-like isoform X1 [Nicotiana tabacum] XP_016459375.1 PREDICTED: pentatricopeptide repeat-containing protein At4g36680, mitochondrial-like isoform X1 [Nicotiana tabacum] XP_016459376.1 PREDICTED: pentatricopeptide repeat-containing protein At4g36680, mitochondrial-like isoform X1 [Nicotiana tabacum] XP_016459377.1 PREDICTED: pentatricopeptide repeat-containing protein At4g36680, mitochondrial-like isoform X1 [Nicotiana tabacum] XP_016459378.1 PREDICTED: pentatricopeptide repeat-containing protein At4g36680, mitochondrial-like isoform X1 [Nicotiana tabacum] XP_016459379.1 PREDICTED: pentatricopeptide repeat-containing protein At4g36680, mitochondrial-like isoform X1 [Nicotiana tabacum] XP_016459380.1 PREDICTED: pentatricopeptide repeat-containing protein At4g36680, mitochondrial-like isoform X1 [Nicotiana tabacum] XP_016459381.1 PREDICTED: pentatricopeptide repeat-containing protein At4g36680, mitochondrial-like isoform X1 [Nicotiana tabacum] XP_016459383.1 PREDICTED: pentatricopeptide repeat-containing protein At4g36680, mitochondrial-like isoform X1 [Nicotiana tabacum] XP_016459384.1 PREDICTED: pentatricopeptide repeat-containing protein At4g36680, mitochondrial-like isoform X1 [Nicotiana tabacum] XP_016459385.1 PREDICTED: pentatricopeptide repeat-containing protein At4g36680, mitochondrial-like isoform X1 [Nicotiana tabacum] Length = 409 Score = 96.7 bits (239), Expect(2) = 9e-19 Identities = 50/92 (54%), Positives = 61/92 (66%), Gaps = 9/92 (9%) Frame = -1 Query: 1391 PQEVLGLMDEMASSGLKPDTISYNYLMTCYCKNGKMDEAKKVY*GLEEKRCLPNATT--- 1221 P+ V L++EM+ +GLKPDTISYNYLMTCYCKNG MDEA+KVY L K C PNA T Sbjct: 253 PEGVKALIEEMSDAGLKPDTISYNYLMTCYCKNGLMDEAQKVYEDLGSKGCNPNAATFRT 312 Query: 1220 ------*EWGFQCGVGIFKASVKKSKIPNFGT 1143 + F+ G +FK SV+ KIP+F T Sbjct: 313 LIFYLCKKGRFETGYKVFKESVRVHKIPDFST 344 Score = 26.9 bits (58), Expect(2) = 9e-19 Identities = 15/26 (57%), Positives = 18/26 (69%) Frame = -3 Query: 1140 KGLVEGLVKNSKVVKAKGSI*EVKKR 1063 K LVEGLV+ SK+ AKG VKK+ Sbjct: 346 KYLVEGLVQRSKLKDAKGMGRTVKKK 371 >XP_009795026.1 PREDICTED: pentatricopeptide repeat-containing protein At4g36680, mitochondrial-like [Nicotiana sylvestris] XP_009795027.1 PREDICTED: pentatricopeptide repeat-containing protein At4g36680, mitochondrial-like [Nicotiana sylvestris] XP_009795028.1 PREDICTED: pentatricopeptide repeat-containing protein At4g36680, mitochondrial-like [Nicotiana sylvestris] XP_009795029.1 PREDICTED: pentatricopeptide repeat-containing protein At4g36680, mitochondrial-like [Nicotiana sylvestris] XP_009795030.1 PREDICTED: pentatricopeptide repeat-containing protein At4g36680, mitochondrial-like [Nicotiana sylvestris] XP_009795031.1 PREDICTED: pentatricopeptide repeat-containing protein At4g36680, mitochondrial-like [Nicotiana sylvestris] XP_009795032.1 PREDICTED: pentatricopeptide repeat-containing protein At4g36680, mitochondrial-like [Nicotiana sylvestris] XP_009795033.1 PREDICTED: pentatricopeptide repeat-containing protein At4g36680, mitochondrial-like [Nicotiana sylvestris] XP_009795034.1 PREDICTED: pentatricopeptide repeat-containing protein At4g36680, mitochondrial-like [Nicotiana sylvestris] Length = 409 Score = 96.7 bits (239), Expect(2) = 9e-19 Identities = 50/92 (54%), Positives = 61/92 (66%), Gaps = 9/92 (9%) Frame = -1 Query: 1391 PQEVLGLMDEMASSGLKPDTISYNYLMTCYCKNGKMDEAKKVY*GLEEKRCLPNATT--- 1221 P+ V L++EM+ +GLKPDTISYNYLMTCYCKNG MDEA+KVY L K C PNA T Sbjct: 253 PEGVKALIEEMSDAGLKPDTISYNYLMTCYCKNGLMDEAQKVYEDLGSKGCNPNAATFRT 312 Query: 1220 ------*EWGFQCGVGIFKASVKKSKIPNFGT 1143 + F+ G +FK SV+ KIP+F T Sbjct: 313 LIFYLCKKGRFETGYKVFKESVRVHKIPDFST 344 Score = 26.9 bits (58), Expect(2) = 9e-19 Identities = 15/26 (57%), Positives = 18/26 (69%) Frame = -3 Query: 1140 KGLVEGLVKNSKVVKAKGSI*EVKKR 1063 K LVEGLV+ SK+ AKG VKK+ Sbjct: 346 KYLVEGLVQRSKLKDAKGMGRTVKKK 371 >XP_016459386.1 PREDICTED: pentatricopeptide repeat-containing protein At4g36680, mitochondrial-like isoform X2 [Nicotiana tabacum] XP_016459387.1 PREDICTED: pentatricopeptide repeat-containing protein At4g36680, mitochondrial-like isoform X2 [Nicotiana tabacum] XP_016459388.1 PREDICTED: pentatricopeptide repeat-containing protein At4g36680, mitochondrial-like isoform X2 [Nicotiana tabacum] Length = 403 Score = 96.7 bits (239), Expect(2) = 9e-19 Identities = 50/92 (54%), Positives = 61/92 (66%), Gaps = 9/92 (9%) Frame = -1 Query: 1391 PQEVLGLMDEMASSGLKPDTISYNYLMTCYCKNGKMDEAKKVY*GLEEKRCLPNATT--- 1221 P+ V L++EM+ +GLKPDTISYNYLMTCYCKNG MDEA+KVY L K C PNA T Sbjct: 253 PEGVKALIEEMSDAGLKPDTISYNYLMTCYCKNGLMDEAQKVYEDLGSKGCNPNAATFRT 312 Query: 1220 ------*EWGFQCGVGIFKASVKKSKIPNFGT 1143 + F+ G +FK SV+ KIP+F T Sbjct: 313 LIFYLCKKGRFETGYKVFKESVRVHKIPDFST 344 Score = 26.9 bits (58), Expect(2) = 9e-19 Identities = 15/26 (57%), Positives = 18/26 (69%) Frame = -3 Query: 1140 KGLVEGLVKNSKVVKAKGSI*EVKKR 1063 K LVEGLV+ SK+ AKG VKK+ Sbjct: 346 KYLVEGLVQRSKLKDAKGMGRTVKKK 371 >CBI17546.3 unnamed protein product, partial [Vitis vinifera] Length = 371 Score = 96.3 bits (238), Expect(2) = 9e-19 Identities = 50/92 (54%), Positives = 61/92 (66%), Gaps = 9/92 (9%) Frame = -1 Query: 1391 PQEVLGLMDEMASSGLKPDTISYNYLMTCYCKNGKMDEAKKVY*GLEEKRCLPNATT--- 1221 P+ V L+DEM+++GLKPDTISYNYLMT YCK+G +DEAKKVY LEE C PNA T Sbjct: 218 PENVKALIDEMSNAGLKPDTISYNYLMTSYCKSGMVDEAKKVYAELEETGCHPNAATFRT 277 Query: 1220 ------*EWGFQCGVGIFKASVKKSKIPNFGT 1143 F+ G +FK S + KIP+FGT Sbjct: 278 LIYYLCRSGDFETGYKVFKQSAFRRKIPDFGT 309 Score = 27.3 bits (59), Expect(2) = 9e-19 Identities = 15/30 (50%), Positives = 19/30 (63%) Frame = -3 Query: 1155 EFWDDKGLVEGLVKNSKVVKAKGSI*EVKK 1066 +F + LVEGLV+ K +AKG I VKK Sbjct: 306 DFGTLRHLVEGLVQKKKTKEAKGLIRTVKK 335 >XP_010277336.1 PREDICTED: pentatricopeptide repeat-containing protein At4g36680, mitochondrial-like [Nelumbo nucifera] Length = 396 Score = 98.2 bits (243), Expect = 1e-18 Identities = 49/92 (53%), Positives = 63/92 (68%), Gaps = 9/92 (9%) Frame = -1 Query: 1391 PQEVLGLMDEMASSGLKPDTISYNYLMTCYCKNGKMDEAKKVY*GLEEKRCLPNATT--- 1221 P+ VL L+ EM+S+GLKPDTISYNYL+TCYCKN +++AKKVY GLE CLPNA T Sbjct: 246 PEAVLALIGEMSSAGLKPDTISYNYLLTCYCKNDMLEDAKKVYEGLEGNGCLPNAATFRT 305 Query: 1220 ------*EWGFQCGVGIFKASVKKSKIPNFGT 1143 F G +++ SV++ KIP+FGT Sbjct: 306 YIYYLCRNGDFGRGFEVYEDSVRRDKIPDFGT 337 >XP_006363148.1 PREDICTED: pentatricopeptide repeat-containing protein At4g36680, mitochondrial-like [Solanum tuberosum] Length = 406 Score = 97.8 bits (242), Expect = 2e-18 Identities = 50/92 (54%), Positives = 62/92 (67%), Gaps = 9/92 (9%) Frame = -1 Query: 1391 PQEVLGLMDEMASSGLKPDTISYNYLMTCYCKNGKMDEAKKVY*GLEEKRCLPNATT--- 1221 P+ V L++EM+ +GLKPDTISYNYLMTCYC+N MDEA+KVY LE+ RC PNA T Sbjct: 259 PEGVKALIEEMSDAGLKPDTISYNYLMTCYCRNELMDEAQKVYDDLEKNRCNPNAATFKT 318 Query: 1220 ------*EWGFQCGVGIFKASVKKSKIPNFGT 1143 + F+ G +FK SVK KIP+F T Sbjct: 319 LIFYLCKKGRFETGYKVFKESVKVQKIPDFNT 350 >XP_016735240.1 PREDICTED: pentatricopeptide repeat-containing protein At4g36680, mitochondrial-like [Gossypium hirsutum] Length = 409 Score = 94.7 bits (234), Expect(2) = 2e-18 Identities = 49/92 (53%), Positives = 61/92 (66%), Gaps = 9/92 (9%) Frame = -1 Query: 1391 PQEVLGLMDEMASSGLKPDTISYNYLMTCYCKNGKMDEAKKVY*GLEEKRCLPNATT--- 1221 P++V L+D+M++ GLKPDTISYNYLMTCYCK G +DEAKKVY GLE C PNA T Sbjct: 258 PEKVKELIDDMSTLGLKPDTISYNYLMTCYCKRGMLDEAKKVYEGLEGNGCNPNAATFRT 317 Query: 1220 ------*EWGFQCGVGIFKASVKKSKIPNFGT 1143 ++ G +FK SV+ KIP+F T Sbjct: 318 LVFYLCLNGLYEQGYKVFKESVRLHKIPDFNT 349 Score = 27.7 bits (60), Expect(2) = 2e-18 Identities = 15/25 (60%), Positives = 16/25 (64%) Frame = -3 Query: 1140 KGLVEGLVKNSKVVKAKGSI*EVKK 1066 K LVEGLV K+ AKG I VKK Sbjct: 351 KHLVEGLVMKKKIKDAKGLIRTVKK 375 >XP_012436918.1 PREDICTED: pentatricopeptide repeat-containing protein At4g36680, mitochondrial [Gossypium raimondii] KJB48422.1 hypothetical protein B456_008G068700 [Gossypium raimondii] Length = 408 Score = 94.7 bits (234), Expect(2) = 2e-18 Identities = 49/92 (53%), Positives = 61/92 (66%), Gaps = 9/92 (9%) Frame = -1 Query: 1391 PQEVLGLMDEMASSGLKPDTISYNYLMTCYCKNGKMDEAKKVY*GLEEKRCLPNATT--- 1221 P++V L+D+M++ GLKPDTISYNYLMTCYCK G +DEAKKVY GLE C PNA T Sbjct: 257 PEKVKELIDDMSTLGLKPDTISYNYLMTCYCKRGMLDEAKKVYEGLEGNGCNPNAATFRT 316 Query: 1220 ------*EWGFQCGVGIFKASVKKSKIPNFGT 1143 ++ G +FK SV+ KIP+F T Sbjct: 317 LVFYLCLNGLYEQGYKVFKESVRLHKIPDFNT 348 Score = 27.7 bits (60), Expect(2) = 2e-18 Identities = 15/25 (60%), Positives = 16/25 (64%) Frame = -3 Query: 1140 KGLVEGLVKNSKVVKAKGSI*EVKK 1066 K LVEGLV K+ AKG I VKK Sbjct: 350 KHLVEGLVMKKKIKDAKGLIRTVKK 374 >XP_019173173.1 PREDICTED: pentatricopeptide repeat-containing protein At4g36680, mitochondrial-like [Ipomoea nil] Length = 398 Score = 97.4 bits (241), Expect = 2e-18 Identities = 50/93 (53%), Positives = 61/93 (65%), Gaps = 9/93 (9%) Frame = -1 Query: 1394 SPQEVLGLMDEMASSGLKPDTISYNYLMTCYCKNGKMDEAKKVY*GLEEKRCLPNATT-- 1221 SP V GL+DEM+++GLKPD ISYNYLMTCYC+NG MDEA++VY LE C PNATT Sbjct: 253 SPDGVKGLIDEMSNAGLKPDIISYNYLMTCYCRNGMMDEAEQVYNSLEANFCKPNATTFR 312 Query: 1220 -------*EWGFQCGVGIFKASVKKSKIPNFGT 1143 + F G +F SV +KIP+F T Sbjct: 313 TLIYYACQQGQFDTGYKVFNKSVAMNKIPDFNT 345