BLASTX nr result
ID: Magnolia22_contig00000819
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Magnolia22_contig00000819 (834 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_015868285.1 PREDICTED: eukaryotic translation initiation fact... 77 4e-13 ONK66121.1 uncharacterized protein A4U43_C06F4360 [Asparagus off... 78 1e-12 OAY51829.1 hypothetical protein MANES_04G036200 [Manihot esculenta] 74 4e-12 XP_008791788.1 PREDICTED: eukaryotic translation initiation fact... 76 6e-12 XP_019704301.1 PREDICTED: eukaryotic translation initiation fact... 76 6e-12 XP_008791787.1 PREDICTED: eukaryotic translation initiation fact... 76 6e-12 JAT43649.1 Eukaryotic translation initiation factor 2A [Anthuriu... 74 4e-11 KCW44729.1 hypothetical protein EUGRSUZ_L01724 [Eucalyptus grandis] 73 5e-11 XP_018722445.1 PREDICTED: LOW QUALITY PROTEIN: eukaryotic transl... 73 5e-11 XP_020111919.1 eukaryotic translation initiation factor 2A [Anan... 73 5e-11 XP_015581729.1 PREDICTED: eukaryotic translation initiation fact... 73 7e-11 EEF31807.1 Eukaryotic translation initiation factor 3 subunit, p... 73 7e-11 XP_010268199.1 PREDICTED: eukaryotic translation initiation fact... 72 8e-11 AKM76406.1 eukaryotic translation initiation factor eIF2A family... 72 9e-11 XP_004309726.1 PREDICTED: eukaryotic translation initiation fact... 72 9e-11 XP_010268198.1 PREDICTED: eukaryotic translation initiation fact... 72 9e-11 XP_010069250.1 PREDICTED: eukaryotic translation initiation fact... 72 9e-11 KCW57543.1 hypothetical protein EUGRSUZ_H00311 [Eucalyptus grandis] 72 1e-10 KZM85052.1 hypothetical protein DCAR_027526 [Daucus carota subsp... 70 1e-10 XP_007222982.1 hypothetical protein PRUPE_ppa004316mg [Prunus pe... 72 2e-10 >XP_015868285.1 PREDICTED: eukaryotic translation initiation factor 2A [Ziziphus jujuba] Length = 258 Score = 77.4 bits (189), Expect = 4e-13 Identities = 33/38 (86%), Positives = 36/38 (94%) Frame = +2 Query: 320 AFWNYSEKKLLGTTKAECSVTSEWSPDGCYFMTATTVY 433 AFW+Y EKK LGTTKAECSVTSEWSPDGCYFMTATT++ Sbjct: 198 AFWDYIEKKQLGTTKAECSVTSEWSPDGCYFMTATTLF 235 >ONK66121.1 uncharacterized protein A4U43_C06F4360 [Asparagus officinalis] Length = 508 Score = 78.2 bits (191), Expect = 1e-12 Identities = 33/36 (91%), Positives = 36/36 (100%) Frame = +2 Query: 320 AFWNYSEKKLLGTTKAECSVTSEWSPDGCYFMTATT 427 AFW+YSEKK+LGTT+AECSVTSEWSPDGCYFMTATT Sbjct: 322 AFWDYSEKKVLGTTRAECSVTSEWSPDGCYFMTATT 357 >OAY51829.1 hypothetical protein MANES_04G036200 [Manihot esculenta] Length = 217 Score = 73.9 bits (180), Expect = 4e-12 Identities = 31/36 (86%), Positives = 34/36 (94%) Frame = +2 Query: 320 AFWNYSEKKLLGTTKAECSVTSEWSPDGCYFMTATT 427 AFW+Y+ KK LGTT+AECSVTSEWSPDGCYFMTATT Sbjct: 48 AFWDYANKKQLGTTRAECSVTSEWSPDGCYFMTATT 83 >XP_008791788.1 PREDICTED: eukaryotic translation initiation factor 2A isoform X2 [Phoenix dactylifera] Length = 514 Score = 75.9 bits (185), Expect = 6e-12 Identities = 34/36 (94%), Positives = 35/36 (97%) Frame = +2 Query: 320 AFWNYSEKKLLGTTKAECSVTSEWSPDGCYFMTATT 427 AFW+YSEKKLLGTTKAECSVTSEWSPDG YFMTATT Sbjct: 343 AFWDYSEKKLLGTTKAECSVTSEWSPDGHYFMTATT 378 >XP_019704301.1 PREDICTED: eukaryotic translation initiation factor 2A [Elaeis guineensis] Length = 515 Score = 75.9 bits (185), Expect = 6e-12 Identities = 34/36 (94%), Positives = 35/36 (97%) Frame = +2 Query: 320 AFWNYSEKKLLGTTKAECSVTSEWSPDGCYFMTATT 427 AFW+YSEKKLLGTTKAECSVTSEWSPDG YFMTATT Sbjct: 343 AFWDYSEKKLLGTTKAECSVTSEWSPDGRYFMTATT 378 >XP_008791787.1 PREDICTED: eukaryotic translation initiation factor 2A isoform X1 [Phoenix dactylifera] Length = 522 Score = 75.9 bits (185), Expect = 6e-12 Identities = 34/36 (94%), Positives = 35/36 (97%) Frame = +2 Query: 320 AFWNYSEKKLLGTTKAECSVTSEWSPDGCYFMTATT 427 AFW+YSEKKLLGTTKAECSVTSEWSPDG YFMTATT Sbjct: 343 AFWDYSEKKLLGTTKAECSVTSEWSPDGHYFMTATT 378 >JAT43649.1 Eukaryotic translation initiation factor 2A [Anthurium amnicola] Length = 515 Score = 73.6 bits (179), Expect = 4e-11 Identities = 32/36 (88%), Positives = 35/36 (97%) Frame = +2 Query: 320 AFWNYSEKKLLGTTKAECSVTSEWSPDGCYFMTATT 427 AFW+YSE++LLGTTKAECSVTSEWSPDG YFMTATT Sbjct: 341 AFWDYSERRLLGTTKAECSVTSEWSPDGRYFMTATT 376 >KCW44729.1 hypothetical protein EUGRSUZ_L01724 [Eucalyptus grandis] Length = 458 Score = 73.2 bits (178), Expect = 5e-11 Identities = 31/36 (86%), Positives = 34/36 (94%) Frame = +2 Query: 320 AFWNYSEKKLLGTTKAECSVTSEWSPDGCYFMTATT 427 AFW+Y EKK LGTTKA+CSVTSEWSP+GCYFMTATT Sbjct: 282 AFWDYREKKQLGTTKADCSVTSEWSPNGCYFMTATT 317 >XP_018722445.1 PREDICTED: LOW QUALITY PROTEIN: eukaryotic translation initiation factor 2A [Eucalyptus grandis] Length = 519 Score = 73.2 bits (178), Expect = 5e-11 Identities = 31/36 (86%), Positives = 34/36 (94%) Frame = +2 Query: 320 AFWNYSEKKLLGTTKAECSVTSEWSPDGCYFMTATT 427 AFW+Y EKK LGTTKA+CSVTSEWSP+GCYFMTATT Sbjct: 343 AFWDYREKKQLGTTKADCSVTSEWSPNGCYFMTATT 378 >XP_020111919.1 eukaryotic translation initiation factor 2A [Ananas comosus] OAY65731.1 Eukaryotic translation initiation factor 2A [Ananas comosus] Length = 530 Score = 73.2 bits (178), Expect = 5e-11 Identities = 33/36 (91%), Positives = 34/36 (94%) Frame = +2 Query: 320 AFWNYSEKKLLGTTKAECSVTSEWSPDGCYFMTATT 427 AFW+YS KKLLGTTKAECSVTSEWSPDG YFMTATT Sbjct: 360 AFWDYSGKKLLGTTKAECSVTSEWSPDGRYFMTATT 395 >XP_015581729.1 PREDICTED: eukaryotic translation initiation factor 2A [Ricinus communis] Length = 514 Score = 72.8 bits (177), Expect = 7e-11 Identities = 31/36 (86%), Positives = 33/36 (91%) Frame = +2 Query: 320 AFWNYSEKKLLGTTKAECSVTSEWSPDGCYFMTATT 427 AFW+Y KK LGTT+AECSVTSEWSPDGCYFMTATT Sbjct: 345 AFWDYVNKKQLGTTRAECSVTSEWSPDGCYFMTATT 380 >EEF31807.1 Eukaryotic translation initiation factor 3 subunit, putative [Ricinus communis] Length = 584 Score = 72.8 bits (177), Expect = 7e-11 Identities = 31/36 (86%), Positives = 33/36 (91%) Frame = +2 Query: 320 AFWNYSEKKLLGTTKAECSVTSEWSPDGCYFMTATT 427 AFW+Y KK LGTT+AECSVTSEWSPDGCYFMTATT Sbjct: 415 AFWDYVNKKQLGTTRAECSVTSEWSPDGCYFMTATT 450 >XP_010268199.1 PREDICTED: eukaryotic translation initiation factor 2A isoform X2 [Nelumbo nucifera] Length = 416 Score = 72.4 bits (176), Expect = 8e-11 Identities = 32/36 (88%), Positives = 34/36 (94%) Frame = +2 Query: 320 AFWNYSEKKLLGTTKAECSVTSEWSPDGCYFMTATT 427 AFW+Y EKKLLGTTKAECSVTSEWSP+G YFMTATT Sbjct: 239 AFWDYVEKKLLGTTKAECSVTSEWSPNGLYFMTATT 274 >AKM76406.1 eukaryotic translation initiation factor eIF2A family protein [Hypseocharis bilobata] Length = 517 Score = 72.4 bits (176), Expect = 9e-11 Identities = 32/36 (88%), Positives = 34/36 (94%) Frame = +2 Query: 320 AFWNYSEKKLLGTTKAECSVTSEWSPDGCYFMTATT 427 AFW+Y+EKK LGTTKAECSVTSEWSPDG YFMTATT Sbjct: 344 AFWDYTEKKQLGTTKAECSVTSEWSPDGRYFMTATT 379 >XP_004309726.1 PREDICTED: eukaryotic translation initiation factor 2A [Fragaria vesca subsp. vesca] Length = 519 Score = 72.4 bits (176), Expect = 9e-11 Identities = 32/36 (88%), Positives = 33/36 (91%) Frame = +2 Query: 320 AFWNYSEKKLLGTTKAECSVTSEWSPDGCYFMTATT 427 AFW+Y EKK LGTTKAE SVTSEWSPDGCYFMTATT Sbjct: 346 AFWDYMEKKQLGTTKAELSVTSEWSPDGCYFMTATT 381 >XP_010268198.1 PREDICTED: eukaryotic translation initiation factor 2A isoform X1 [Nelumbo nucifera] Length = 520 Score = 72.4 bits (176), Expect = 9e-11 Identities = 32/36 (88%), Positives = 34/36 (94%) Frame = +2 Query: 320 AFWNYSEKKLLGTTKAECSVTSEWSPDGCYFMTATT 427 AFW+Y EKKLLGTTKAECSVTSEWSP+G YFMTATT Sbjct: 343 AFWDYVEKKLLGTTKAECSVTSEWSPNGLYFMTATT 378 >XP_010069250.1 PREDICTED: eukaryotic translation initiation factor 2A [Eucalyptus grandis] Length = 520 Score = 72.4 bits (176), Expect = 9e-11 Identities = 31/36 (86%), Positives = 33/36 (91%) Frame = +2 Query: 320 AFWNYSEKKLLGTTKAECSVTSEWSPDGCYFMTATT 427 AFW+Y EKK LG TKAECSVTSEWSP+GCYFMTATT Sbjct: 344 AFWDYREKKQLGATKAECSVTSEWSPNGCYFMTATT 379 >KCW57543.1 hypothetical protein EUGRSUZ_H00311 [Eucalyptus grandis] Length = 612 Score = 72.4 bits (176), Expect = 1e-10 Identities = 31/36 (86%), Positives = 33/36 (91%) Frame = +2 Query: 320 AFWNYSEKKLLGTTKAECSVTSEWSPDGCYFMTATT 427 AFW+Y EKK LG TKAECSVTSEWSP+GCYFMTATT Sbjct: 436 AFWDYREKKQLGATKAECSVTSEWSPNGCYFMTATT 471 >KZM85052.1 hypothetical protein DCAR_027526 [Daucus carota subsp. sativus] Length = 203 Score = 69.7 bits (169), Expect = 1e-10 Identities = 30/37 (81%), Positives = 33/37 (89%) Frame = +2 Query: 317 QAFWNYSEKKLLGTTKAECSVTSEWSPDGCYFMTATT 427 + FW+Y EKK LGTTKAE SVTSEWSPDGCYF+TATT Sbjct: 28 EVFWDYVEKKKLGTTKAEWSVTSEWSPDGCYFLTATT 64 >XP_007222982.1 hypothetical protein PRUPE_ppa004316mg [Prunus persica] ONI29636.1 hypothetical protein PRUPE_1G207000 [Prunus persica] Length = 517 Score = 71.6 bits (174), Expect = 2e-10 Identities = 31/36 (86%), Positives = 33/36 (91%) Frame = +2 Query: 320 AFWNYSEKKLLGTTKAECSVTSEWSPDGCYFMTATT 427 AFW+Y EKK LGTT+AE SVTSEWSPDGCYFMTATT Sbjct: 344 AFWDYGEKKQLGTTRAELSVTSEWSPDGCYFMTATT 379