BLASTX nr result
ID: Lithospermum23_contig00013221
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Lithospermum23_contig00013221 (381 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_015950046.1 PREDICTED: zinc finger BED domain-containing prot... 54 5e-06 >XP_015950046.1 PREDICTED: zinc finger BED domain-containing protein DAYSLEEPER-like [Arachis duranensis] Length = 561 Score = 54.3 bits (129), Expect = 5e-06 Identities = 23/55 (41%), Positives = 31/55 (56%) Frame = -2 Query: 299 SVAWLHFDPITMPSGIKKNKCKHCNKLMSVQKKKTTTHLIRHLKEACPMRHKIFL 135 S W HF + + +GI KN+C HC + +V K T+ L RHLK CP K+ L Sbjct: 81 SFVWQHFKEVKLSNGIVKNQCVHCKRKYAVTDSKATSQLNRHLKNNCPSYRKMML 135