BLASTX nr result
ID: Lithospermum22_contig00035524
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Lithospermum22_contig00035524 (202 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CAF75219.1| putative fructose-2,6-bisphosphatase [Silene vul... 64 2e-08 gb|ACB86611.1| putative fructose-2,6-bisphosphatase [Silene conica] 62 4e-08 gb|ACB86606.1| Y4 [Silene latifolia] 61 8e-08 gb|ACB86605.1| X4 [Silene latifolia] 61 8e-08 emb|CAF75215.1| putative fructose-2,6-bisphosphatase [Silene dic... 61 8e-08 >emb|CAF75219.1| putative fructose-2,6-bisphosphatase [Silene vulgaris] Length = 370 Score = 63.5 bits (153), Expect = 2e-08 Identities = 37/70 (52%), Positives = 41/70 (58%), Gaps = 4/70 (5%) Frame = +3 Query: 3 LSPQLSTYGTPRLGPSIKVWDPYNVXXXXXXXXXXXXXQFNRGYSGDNVEGFG---RGS- 170 LSPQLS+ GTPR+GPSIKVWDPYNV F R YS D + G RGS Sbjct: 56 LSPQLSSLGTPRMGPSIKVWDPYNV-LAPPPPLPPPPSSFGRSYSSDGMVMVGSEERGSV 114 Query: 171 FTEIYLICHG 200 E+YLI HG Sbjct: 115 IMEVYLISHG 124 >gb|ACB86611.1| putative fructose-2,6-bisphosphatase [Silene conica] Length = 371 Score = 62.4 bits (150), Expect = 4e-08 Identities = 36/70 (51%), Positives = 41/70 (58%), Gaps = 4/70 (5%) Frame = +3 Query: 3 LSPQLSTYGTPRLGPSIKVWDPYNVXXXXXXXXXXXXXQFNRGYSGDNVEGFG---RGS- 170 LSPQLS+ GTPR+GPSIKVWDPYNV F R YS D + G RG+ Sbjct: 57 LSPQLSSLGTPRMGPSIKVWDPYNV-LAPPPPLPPPPSSFGRSYSSDGMVMVGSEERGNV 115 Query: 171 FTEIYLICHG 200 E+YLI HG Sbjct: 116 MMEVYLISHG 125 >gb|ACB86606.1| Y4 [Silene latifolia] Length = 422 Score = 61.2 bits (147), Expect = 8e-08 Identities = 36/69 (52%), Positives = 40/69 (57%), Gaps = 3/69 (4%) Frame = +3 Query: 3 LSPQLSTYGTPRLGPSIKVWDPYNVXXXXXXXXXXXXXQFNRGYSGDN--VEGFGRGS-F 173 LSPQLS+ GTPR+GPSIKVWDPYNV F R YS D V RG+ Sbjct: 62 LSPQLSSLGTPRMGPSIKVWDPYNV-LAPPPPLPPPPSSFGRSYSSDGIVVGSEERGNVM 120 Query: 174 TEIYLICHG 200 E+YLI HG Sbjct: 121 MEVYLISHG 129 >gb|ACB86605.1| X4 [Silene latifolia] Length = 427 Score = 61.2 bits (147), Expect = 8e-08 Identities = 36/69 (52%), Positives = 40/69 (57%), Gaps = 3/69 (4%) Frame = +3 Query: 3 LSPQLSTYGTPRLGPSIKVWDPYNVXXXXXXXXXXXXXQFNRGYSGDN--VEGFGRGS-F 173 LSPQLS+ GTPR+GPSIKVWDPYNV F R YS D V RG+ Sbjct: 67 LSPQLSSLGTPRMGPSIKVWDPYNV-LAPPPPLPPPPASFGRSYSSDGMVVGSEERGNVI 125 Query: 174 TEIYLICHG 200 E+YLI HG Sbjct: 126 MEVYLISHG 134 >emb|CAF75215.1| putative fructose-2,6-bisphosphatase [Silene diclinis] Length = 370 Score = 61.2 bits (147), Expect = 8e-08 Identities = 36/69 (52%), Positives = 40/69 (57%), Gaps = 3/69 (4%) Frame = +3 Query: 3 LSPQLSTYGTPRLGPSIKVWDPYNVXXXXXXXXXXXXXQFNRGYSGDN--VEGFGRGS-F 173 LSPQLS+ GTPR+GPSIKVWDPYNV F R YS D V RG+ Sbjct: 57 LSPQLSSLGTPRMGPSIKVWDPYNV-LAPPPPLPPPPASFGRSYSSDGMVVGSEERGNVI 115 Query: 174 TEIYLICHG 200 E+YLI HG Sbjct: 116 MEVYLISHG 124