BLASTX nr result
ID: Jatropha_contig00024560
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Jatropha_contig00024560 (314 letters) Database: NCBI-nr (updated 2014/02/11) 35,149,712 sequences; 12,374,887,350 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ERP51131.1| hypothetical protein POPTR_0017s12240g [Populus t... 135 7e-30 gb|ERP51130.1| hypothetical protein POPTR_0017s12240g [Populus t... 135 7e-30 ref|XP_002323872.1| predicted protein [Populus trichocarpa] gi|2... 135 7e-30 gb|ABK96139.1| unknown [Populus trichocarpa] 135 7e-30 ref|XP_002529997.1| cystathionine gamma-synthase, putative [Rici... 129 4e-28 gb|EOY03529.1| Pyridoxal phosphate-dependent transferases superf... 126 3e-27 gb|EOY03528.1| Pyridoxal phosphate-dependent transferases superf... 126 3e-27 emb|CBI22246.3| unnamed protein product [Vitis vinifera] 125 4e-27 ref|XP_002283866.1| PREDICTED: cystathionine gamma-synthase, chl... 125 4e-27 pdb|1QGN|A Chain A, Cystathionine Gamma-Synthase From Nicotiana ... 125 4e-27 gb|ESQ49916.1| hypothetical protein EUTSA_v10020394mg [Eutrema s... 125 5e-27 gb|AAM13883.1| putative cystathionine gamma-synthase [Arabidopsi... 125 5e-27 gb|AAC49574.1| similar to the metB gene product of Escherichia c... 125 5e-27 ref|NP_186761.1| cystathionine gamma-synthase [Arabidopsis thali... 125 5e-27 ref|XP_002882199.1| hypothetical protein ARALYDRAFT_477417 [Arab... 125 5e-27 ref|NP_001266947.1| cystathionine gamma-synthase, chloroplastic-... 125 5e-27 emb|CAA64383.1| cystathionine gamma-synthase [Arabidopsis thaliana] 125 5e-27 ref|XP_006297283.1| hypothetical protein CARUB_v10013298mg, part... 125 7e-27 gb|EMJ17201.1| hypothetical protein PRUPE_ppa004232mg [Prunus pe... 124 9e-27 gb|ESW11529.1| hypothetical protein PHAVU_008G038100g [Phaseolus... 124 2e-26 >gb|ERP51131.1| hypothetical protein POPTR_0017s12240g [Populus trichocarpa] Length = 431 Score = 135 bits (339), Expect = 7e-30 Identities = 63/73 (86%), Positives = 70/73 (95%) Frame = +3 Query: 93 ASHLLLGHNDVLGGCISGSTKIISEIRNLHHILGGTLNPNAAYLIIRGMKTLHLRVQQQN 272 A+ + GHNDVLGGCISGSTK++SEIRNLHH+LGGTLNPNAAYLIIRGMKTLHLRVQQQN Sbjct: 343 ATKFIGGHNDVLGGCISGSTKVVSEIRNLHHVLGGTLNPNAAYLIIRGMKTLHLRVQQQN 402 Query: 273 STAMRMAKVLEAH 311 STA+RMAK+LEAH Sbjct: 403 STALRMAKILEAH 415 >gb|ERP51130.1| hypothetical protein POPTR_0017s12240g [Populus trichocarpa] Length = 548 Score = 135 bits (339), Expect = 7e-30 Identities = 63/73 (86%), Positives = 70/73 (95%) Frame = +3 Query: 93 ASHLLLGHNDVLGGCISGSTKIISEIRNLHHILGGTLNPNAAYLIIRGMKTLHLRVQQQN 272 A+ + GHNDVLGGCISGSTK++SEIRNLHH+LGGTLNPNAAYLIIRGMKTLHLRVQQQN Sbjct: 359 ATKFIGGHNDVLGGCISGSTKVVSEIRNLHHVLGGTLNPNAAYLIIRGMKTLHLRVQQQN 418 Query: 273 STAMRMAKVLEAH 311 STA+RMAK+LEAH Sbjct: 419 STALRMAKILEAH 431 Score = 67.0 bits (162), Expect = 2e-09 Identities = 32/38 (84%), Positives = 35/38 (92%) Frame = -1 Query: 116 MAKQQMTGFGGVVSFEVDGDLKTTIKFVDSLKIPYIAP 3 +AK+QMTGFGGVVSFEVDGDL T KFVD+LKIPYIAP Sbjct: 450 IAKKQMTGFGGVVSFEVDGDLFITSKFVDALKIPYIAP 487 >ref|XP_002323872.1| predicted protein [Populus trichocarpa] gi|222866874|gb|EEF04005.1| cystathionine gamma synthase family protein [Populus trichocarpa] Length = 532 Score = 135 bits (339), Expect = 7e-30 Identities = 63/73 (86%), Positives = 70/73 (95%) Frame = +3 Query: 93 ASHLLLGHNDVLGGCISGSTKIISEIRNLHHILGGTLNPNAAYLIIRGMKTLHLRVQQQN 272 A+ + GHNDVLGGCISGSTK++SEIRNLHH+LGGTLNPNAAYLIIRGMKTLHLRVQQQN Sbjct: 343 ATKFIGGHNDVLGGCISGSTKVVSEIRNLHHVLGGTLNPNAAYLIIRGMKTLHLRVQQQN 402 Query: 273 STAMRMAKVLEAH 311 STA+RMAK+LEAH Sbjct: 403 STALRMAKILEAH 415 Score = 67.0 bits (162), Expect = 2e-09 Identities = 32/38 (84%), Positives = 35/38 (92%) Frame = -1 Query: 116 MAKQQMTGFGGVVSFEVDGDLKTTIKFVDSLKIPYIAP 3 +AK+QMTGFGGVVSFEVDGDL T KFVD+LKIPYIAP Sbjct: 434 IAKKQMTGFGGVVSFEVDGDLFITSKFVDALKIPYIAP 471 >gb|ABK96139.1| unknown [Populus trichocarpa] Length = 310 Score = 135 bits (339), Expect = 7e-30 Identities = 63/73 (86%), Positives = 70/73 (95%) Frame = +3 Query: 93 ASHLLLGHNDVLGGCISGSTKIISEIRNLHHILGGTLNPNAAYLIIRGMKTLHLRVQQQN 272 A+ + GHNDVLGGCISGSTK++SEIRNLHH+LGGTLNPNAAYLIIRGMKTLHLRVQQQN Sbjct: 121 ATKFIGGHNDVLGGCISGSTKVVSEIRNLHHVLGGTLNPNAAYLIIRGMKTLHLRVQQQN 180 Query: 273 STAMRMAKVLEAH 311 STA+RMAK+LEAH Sbjct: 181 STALRMAKILEAH 193 Score = 67.0 bits (162), Expect = 2e-09 Identities = 32/38 (84%), Positives = 35/38 (92%) Frame = -1 Query: 116 MAKQQMTGFGGVVSFEVDGDLKTTIKFVDSLKIPYIAP 3 +AK+QMTGFGGVVSFEVDGDL T KFVD+LKIPYIAP Sbjct: 212 IAKKQMTGFGGVVSFEVDGDLFITSKFVDALKIPYIAP 249 >ref|XP_002529997.1| cystathionine gamma-synthase, putative [Ricinus communis] gi|223530476|gb|EEF32359.1| cystathionine gamma-synthase, putative [Ricinus communis] Length = 425 Score = 129 bits (324), Expect = 4e-28 Identities = 61/73 (83%), Positives = 68/73 (93%) Frame = +3 Query: 93 ASHLLLGHNDVLGGCISGSTKIISEIRNLHHILGGTLNPNAAYLIIRGMKTLHLRVQQQN 272 A+ + GHNDVL GCISGS K++SEIRNLHHILGGTLNPNAAYLIIRGMKTLHLRVQQQN Sbjct: 239 ATKFIGGHNDVLAGCISGSAKLVSEIRNLHHILGGTLNPNAAYLIIRGMKTLHLRVQQQN 298 Query: 273 STAMRMAKVLEAH 311 STA+RMA++LEAH Sbjct: 299 STALRMAEILEAH 311 Score = 72.4 bits (176), Expect = 5e-11 Identities = 34/38 (89%), Positives = 37/38 (97%) Frame = -1 Query: 116 MAKQQMTGFGGVVSFEVDGDLKTTIKFVDSLKIPYIAP 3 +AK+QMTGFGGVVSFEVDGDL TTIKFVD+LKIPYIAP Sbjct: 330 IAKRQMTGFGGVVSFEVDGDLMTTIKFVDALKIPYIAP 367 >gb|EOY03529.1| Pyridoxal phosphate-dependent transferases superfamily protein isoform 2 [Theobroma cacao] Length = 541 Score = 126 bits (316), Expect = 3e-27 Identities = 60/73 (82%), Positives = 67/73 (91%) Frame = +3 Query: 93 ASHLLLGHNDVLGGCISGSTKIISEIRNLHHILGGTLNPNAAYLIIRGMKTLHLRVQQQN 272 A+ + GHNDVL GC+SGS K+I+EIR LHHILGGTLNPNAAYLIIRGMKTLHLRVQQQN Sbjct: 355 ATKFIGGHNDVLAGCVSGSEKLITEIRTLHHILGGTLNPNAAYLIIRGMKTLHLRVQQQN 414 Query: 273 STAMRMAKVLEAH 311 STA++MAKVLEAH Sbjct: 415 STALKMAKVLEAH 427 Score = 71.2 bits (173), Expect = 1e-10 Identities = 34/38 (89%), Positives = 36/38 (94%) Frame = -1 Query: 116 MAKQQMTGFGGVVSFEVDGDLKTTIKFVDSLKIPYIAP 3 +AK QMTGFGGVVSFEVDGDL TTIKFVD+LKIPYIAP Sbjct: 446 IAKLQMTGFGGVVSFEVDGDLMTTIKFVDALKIPYIAP 483 >gb|EOY03528.1| Pyridoxal phosphate-dependent transferases superfamily protein isoform 1 [Theobroma cacao] Length = 559 Score = 126 bits (316), Expect = 3e-27 Identities = 60/73 (82%), Positives = 67/73 (91%) Frame = +3 Query: 93 ASHLLLGHNDVLGGCISGSTKIISEIRNLHHILGGTLNPNAAYLIIRGMKTLHLRVQQQN 272 A+ + GHNDVL GC+SGS K+I+EIR LHHILGGTLNPNAAYLIIRGMKTLHLRVQQQN Sbjct: 373 ATKFIGGHNDVLAGCVSGSEKLITEIRTLHHILGGTLNPNAAYLIIRGMKTLHLRVQQQN 432 Query: 273 STAMRMAKVLEAH 311 STA++MAKVLEAH Sbjct: 433 STALKMAKVLEAH 445 Score = 71.2 bits (173), Expect = 1e-10 Identities = 34/38 (89%), Positives = 36/38 (94%) Frame = -1 Query: 116 MAKQQMTGFGGVVSFEVDGDLKTTIKFVDSLKIPYIAP 3 +AK QMTGFGGVVSFEVDGDL TTIKFVD+LKIPYIAP Sbjct: 464 IAKLQMTGFGGVVSFEVDGDLMTTIKFVDALKIPYIAP 501 >emb|CBI22246.3| unnamed protein product [Vitis vinifera] Length = 497 Score = 125 bits (315), Expect = 4e-27 Identities = 58/73 (79%), Positives = 66/73 (90%) Frame = +3 Query: 93 ASHLLLGHNDVLGGCISGSTKIISEIRNLHHILGGTLNPNAAYLIIRGMKTLHLRVQQQN 272 A+ + GHNDV+ GCISGS K++S IRNLHH+LGG LNPNAAYLIIRGMKTLHLRVQQQN Sbjct: 311 ATKYIAGHNDVIAGCISGSEKLVSTIRNLHHVLGGVLNPNAAYLIIRGMKTLHLRVQQQN 370 Query: 273 STAMRMAKVLEAH 311 STA+RMAK+LEAH Sbjct: 371 STALRMAKILEAH 383 Score = 72.4 bits (176), Expect = 5e-11 Identities = 34/38 (89%), Positives = 37/38 (97%) Frame = -1 Query: 116 MAKQQMTGFGGVVSFEVDGDLKTTIKFVDSLKIPYIAP 3 +AK+QMTGFGGVVSFEVDGDL TTIKFVD+LKIPYIAP Sbjct: 402 IAKRQMTGFGGVVSFEVDGDLTTTIKFVDALKIPYIAP 439 >ref|XP_002283866.1| PREDICTED: cystathionine gamma-synthase, chloroplastic-like [Vitis vinifera] Length = 531 Score = 125 bits (315), Expect = 4e-27 Identities = 58/73 (79%), Positives = 66/73 (90%) Frame = +3 Query: 93 ASHLLLGHNDVLGGCISGSTKIISEIRNLHHILGGTLNPNAAYLIIRGMKTLHLRVQQQN 272 A+ + GHNDV+ GCISGS K++S IRNLHH+LGG LNPNAAYLIIRGMKTLHLRVQQQN Sbjct: 345 ATKYIAGHNDVIAGCISGSEKLVSTIRNLHHVLGGVLNPNAAYLIIRGMKTLHLRVQQQN 404 Query: 273 STAMRMAKVLEAH 311 STA+RMAK+LEAH Sbjct: 405 STALRMAKILEAH 417 Score = 72.4 bits (176), Expect = 5e-11 Identities = 34/38 (89%), Positives = 37/38 (97%) Frame = -1 Query: 116 MAKQQMTGFGGVVSFEVDGDLKTTIKFVDSLKIPYIAP 3 +AK+QMTGFGGVVSFEVDGDL TTIKFVD+LKIPYIAP Sbjct: 436 IAKRQMTGFGGVVSFEVDGDLTTTIKFVDALKIPYIAP 473 >pdb|1QGN|A Chain A, Cystathionine Gamma-Synthase From Nicotiana Tabacum gi|5822271|pdb|1QGN|B Chain B, Cystathionine Gamma-Synthase From Nicotiana Tabacum gi|5822272|pdb|1QGN|C Chain C, Cystathionine Gamma-Synthase From Nicotiana Tabacum gi|5822273|pdb|1QGN|D Chain D, Cystathionine Gamma-Synthase From Nicotiana Tabacum gi|5822274|pdb|1QGN|E Chain E, Cystathionine Gamma-Synthase From Nicotiana Tabacum gi|5822275|pdb|1QGN|F Chain F, Cystathionine Gamma-Synthase From Nicotiana Tabacum gi|5822276|pdb|1QGN|G Chain G, Cystathionine Gamma-Synthase From Nicotiana Tabacum gi|5822277|pdb|1QGN|H Chain H, Cystathionine Gamma-Synthase From Nicotiana Tabacum gi|15826471|pdb|1I41|A Chain A, Cystathionine Gamma-Synthase In Complex With The Inhibitor Appa gi|15826472|pdb|1I41|B Chain B, Cystathionine Gamma-Synthase In Complex With The Inhibitor Appa gi|15826473|pdb|1I41|C Chain C, Cystathionine Gamma-Synthase In Complex With The Inhibitor Appa gi|15826474|pdb|1I41|D Chain D, Cystathionine Gamma-Synthase In Complex With The Inhibitor Appa gi|15826475|pdb|1I41|E Chain E, Cystathionine Gamma-Synthase In Complex With The Inhibitor Appa gi|15826476|pdb|1I41|F Chain F, Cystathionine Gamma-Synthase In Complex With The Inhibitor Appa gi|15826477|pdb|1I41|G Chain G, Cystathionine Gamma-Synthase In Complex With The Inhibitor Appa gi|15826478|pdb|1I41|H Chain H, Cystathionine Gamma-Synthase In Complex With The Inhibitor Appa gi|15826479|pdb|1I41|I Chain I, Cystathionine Gamma-Synthase In Complex With The Inhibitor Appa gi|15826480|pdb|1I41|J Chain J, Cystathionine Gamma-Synthase In Complex With The Inhibitor Appa gi|15826481|pdb|1I41|K Chain K, Cystathionine Gamma-Synthase In Complex With The Inhibitor Appa gi|15826482|pdb|1I41|L Chain L, Cystathionine Gamma-Synthase In Complex With The Inhibitor Appa gi|15826483|pdb|1I43|A Chain A, Cystathionine Gamma-Synthase In Complex With The Inhibitor Ppca gi|15826484|pdb|1I43|B Chain B, Cystathionine Gamma-Synthase In Complex With The Inhibitor Ppca gi|15826485|pdb|1I43|C Chain C, Cystathionine Gamma-Synthase In Complex With The Inhibitor Ppca gi|15826486|pdb|1I43|D Chain D, Cystathionine Gamma-Synthase In Complex With The Inhibitor Ppca gi|15826487|pdb|1I43|E Chain E, Cystathionine Gamma-Synthase In Complex With The Inhibitor Ppca gi|15826488|pdb|1I43|F Chain F, Cystathionine Gamma-Synthase In Complex With The Inhibitor Ppca gi|15826489|pdb|1I43|G Chain G, Cystathionine Gamma-Synthase In Complex With The Inhibitor Ppca gi|15826490|pdb|1I43|H Chain H, Cystathionine Gamma-Synthase In Complex With The Inhibitor Ppca gi|15826491|pdb|1I43|I Chain I, Cystathionine Gamma-Synthase In Complex With The Inhibitor Ppca gi|15826492|pdb|1I43|J Chain J, Cystathionine Gamma-Synthase In Complex With The Inhibitor Ppca gi|15826493|pdb|1I43|K Chain K, Cystathionine Gamma-Synthase In Complex With The Inhibitor Ppca gi|15826494|pdb|1I43|L Chain L, Cystathionine Gamma-Synthase In Complex With The Inhibitor Ppca gi|15826495|pdb|1I48|A Chain A, Cystathionine Gamma-Synthase In Complex With The Inhibitor Ctcpo gi|15826496|pdb|1I48|B Chain B, Cystathionine Gamma-Synthase In Complex With The Inhibitor Ctcpo gi|15826497|pdb|1I48|C Chain C, Cystathionine Gamma-Synthase In Complex With The Inhibitor Ctcpo gi|15826498|pdb|1I48|D Chain D, Cystathionine Gamma-Synthase In Complex With The Inhibitor Ctcpo gi|15826499|pdb|1I48|E Chain E, Cystathionine Gamma-Synthase In Complex With The Inhibitor Ctcpo gi|15826500|pdb|1I48|F Chain F, Cystathionine Gamma-Synthase In Complex With The Inhibitor Ctcpo gi|15826501|pdb|1I48|G Chain G, Cystathionine Gamma-Synthase In Complex With The Inhibitor Ctcpo gi|15826502|pdb|1I48|H Chain H, Cystathionine Gamma-Synthase In Complex With The Inhibitor Ctcpo gi|15826503|pdb|1I48|I Chain I, Cystathionine Gamma-Synthase In Complex With The Inhibitor Ctcpo gi|15826504|pdb|1I48|J Chain J, Cystathionine Gamma-Synthase In Complex With The Inhibitor Ctcpo gi|15826505|pdb|1I48|K Chain K, Cystathionine Gamma-Synthase In Complex With The Inhibitor Ctcpo gi|15826506|pdb|1I48|L Chain L, Cystathionine Gamma-Synthase In Complex With The Inhibitor Ctcpo gi|4322948|gb|AAD16143.1| cystathionine gamma-synthase precursor [Nicotiana tabacum] Length = 445 Score = 125 bits (315), Expect = 4e-27 Identities = 60/73 (82%), Positives = 66/73 (90%) Frame = +3 Query: 93 ASHLLLGHNDVLGGCISGSTKIISEIRNLHHILGGTLNPNAAYLIIRGMKTLHLRVQQQN 272 A+ L GHNDVL GCISG K++SEIRNLHHILGG LNPNAAYLIIRGMKTLHLRVQQQN Sbjct: 259 ATKFLGGHNDVLAGCISGPLKLVSEIRNLHHILGGALNPNAAYLIIRGMKTLHLRVQQQN 318 Query: 273 STAMRMAKVLEAH 311 STA+RMA++LEAH Sbjct: 319 STALRMAEILEAH 331 Score = 68.6 bits (166), Expect = 8e-10 Identities = 32/38 (84%), Positives = 35/38 (92%) Frame = -1 Query: 116 MAKQQMTGFGGVVSFEVDGDLKTTIKFVDSLKIPYIAP 3 +AK+QMTGFGG VSFEVDGDL TT KFVD+LKIPYIAP Sbjct: 350 IAKKQMTGFGGAVSFEVDGDLLTTAKFVDALKIPYIAP 387 >gb|ESQ49916.1| hypothetical protein EUTSA_v10020394mg [Eutrema salsugineum] Length = 568 Score = 125 bits (314), Expect = 5e-27 Identities = 60/73 (82%), Positives = 66/73 (90%) Frame = +3 Query: 93 ASHLLLGHNDVLGGCISGSTKIISEIRNLHHILGGTLNPNAAYLIIRGMKTLHLRVQQQN 272 A+ + GHNDVL GCI GS K+ISEIRNLHH+LGGTLNPNAAYLIIRGMKT+HLRVQQQN Sbjct: 382 ATKYIGGHNDVLAGCICGSLKVISEIRNLHHVLGGTLNPNAAYLIIRGMKTMHLRVQQQN 441 Query: 273 STAMRMAKVLEAH 311 STA RMA+VLEAH Sbjct: 442 STASRMAEVLEAH 454 Score = 73.9 bits (180), Expect = 2e-11 Identities = 35/45 (77%), Positives = 41/45 (91%) Frame = -1 Query: 137 ASSKDIIMAKQQMTGFGGVVSFEVDGDLKTTIKFVDSLKIPYIAP 3 AS + +AK+QMTGFGGVVSFE+DGD++TTIKFVDSLKIPYIAP Sbjct: 466 ASHPEHHIAKRQMTGFGGVVSFEIDGDIETTIKFVDSLKIPYIAP 510 >gb|AAM13883.1| putative cystathionine gamma-synthase [Arabidopsis thaliana] Length = 563 Score = 125 bits (314), Expect = 5e-27 Identities = 59/73 (80%), Positives = 66/73 (90%) Frame = +3 Query: 93 ASHLLLGHNDVLGGCISGSTKIISEIRNLHHILGGTLNPNAAYLIIRGMKTLHLRVQQQN 272 A+ + GHNDVL GCI GS K++SEIRNLHH+LGGTLNPNAAYLIIRGMKTLHLRVQQQN Sbjct: 377 ATKYIGGHNDVLAGCICGSLKLVSEIRNLHHVLGGTLNPNAAYLIIRGMKTLHLRVQQQN 436 Query: 273 STAMRMAKVLEAH 311 STA RMA++LEAH Sbjct: 437 STAFRMAEILEAH 449 Score = 73.6 bits (179), Expect = 2e-11 Identities = 33/38 (86%), Positives = 38/38 (100%) Frame = -1 Query: 116 MAKQQMTGFGGVVSFEVDGDLKTTIKFVDSLKIPYIAP 3 +AK+QMTGFGGVVSFE+DGD++TTIKFVDSLKIPYIAP Sbjct: 468 LAKRQMTGFGGVVSFEIDGDIETTIKFVDSLKIPYIAP 505 >gb|AAC49574.1| similar to the metB gene product of Escherichia coli; cloned by functional complementation of a metB mutant strain of Escherichia coli LE392 [Arabidopsis thaliana] Length = 563 Score = 125 bits (314), Expect = 5e-27 Identities = 59/73 (80%), Positives = 66/73 (90%) Frame = +3 Query: 93 ASHLLLGHNDVLGGCISGSTKIISEIRNLHHILGGTLNPNAAYLIIRGMKTLHLRVQQQN 272 A+ + GHNDVL GCI GS K++SEIRNLHH+LGGTLNPNAAYLIIRGMKTLHLRVQQQN Sbjct: 377 ATKYIGGHNDVLAGCICGSLKLVSEIRNLHHVLGGTLNPNAAYLIIRGMKTLHLRVQQQN 436 Query: 273 STAMRMAKVLEAH 311 STA RMA++LEAH Sbjct: 437 STAFRMAEILEAH 449 Score = 73.6 bits (179), Expect = 2e-11 Identities = 33/38 (86%), Positives = 38/38 (100%) Frame = -1 Query: 116 MAKQQMTGFGGVVSFEVDGDLKTTIKFVDSLKIPYIAP 3 +AK+QMTGFGGVVSFE+DGD++TTIKFVDSLKIPYIAP Sbjct: 468 LAKRQMTGFGGVVSFEIDGDIETTIKFVDSLKIPYIAP 505 >ref|NP_186761.1| cystathionine gamma-synthase [Arabidopsis thaliana] gi|21542422|sp|P55217.3|METB_ARATH RecName: Full=Cystathionine gamma-synthase, chloroplastic; Short=CGS; AltName: Full=O-succinylhomoserine (thiol)-lyase; Flags: Precursor gi|6714476|gb|AAF26162.1|AC008261_19 putative cystathionine gamma-synthase [Arabidopsis thaliana] gi|1791309|gb|AAB41235.1| cystathionine gamma-synthase [Arabidopsis thaliana] gi|2852454|dbj|BAA24699.1| cystathionine gamma-synthase [Arabidopsis thaliana] gi|20453137|gb|AAM19810.1| AT3g01120/T4P13_19 [Arabidopsis thaliana] gi|27754257|gb|AAO22582.1| putative cystathionine gamma-synthase [Arabidopsis thaliana] gi|332640091|gb|AEE73612.1| cystathionine gamma-synthase [Arabidopsis thaliana] Length = 563 Score = 125 bits (314), Expect = 5e-27 Identities = 59/73 (80%), Positives = 66/73 (90%) Frame = +3 Query: 93 ASHLLLGHNDVLGGCISGSTKIISEIRNLHHILGGTLNPNAAYLIIRGMKTLHLRVQQQN 272 A+ + GHNDVL GCI GS K++SEIRNLHH+LGGTLNPNAAYLIIRGMKTLHLRVQQQN Sbjct: 377 ATKYIGGHNDVLAGCICGSLKLVSEIRNLHHVLGGTLNPNAAYLIIRGMKTLHLRVQQQN 436 Query: 273 STAMRMAKVLEAH 311 STA RMA++LEAH Sbjct: 437 STAFRMAEILEAH 449 Score = 73.6 bits (179), Expect = 2e-11 Identities = 33/38 (86%), Positives = 38/38 (100%) Frame = -1 Query: 116 MAKQQMTGFGGVVSFEVDGDLKTTIKFVDSLKIPYIAP 3 +AK+QMTGFGGVVSFE+DGD++TTIKFVDSLKIPYIAP Sbjct: 468 LAKRQMTGFGGVVSFEIDGDIETTIKFVDSLKIPYIAP 505 >ref|XP_002882199.1| hypothetical protein ARALYDRAFT_477417 [Arabidopsis lyrata subsp. lyrata] gi|297328039|gb|EFH58458.1| hypothetical protein ARALYDRAFT_477417 [Arabidopsis lyrata subsp. lyrata] Length = 564 Score = 125 bits (314), Expect = 5e-27 Identities = 59/73 (80%), Positives = 66/73 (90%) Frame = +3 Query: 93 ASHLLLGHNDVLGGCISGSTKIISEIRNLHHILGGTLNPNAAYLIIRGMKTLHLRVQQQN 272 A+ + GHNDVL GCI GS K++SEIRNLHH+LGGTLNPNAAYLIIRGMKTLHLRVQQQN Sbjct: 378 ATKYIGGHNDVLAGCICGSLKLVSEIRNLHHVLGGTLNPNAAYLIIRGMKTLHLRVQQQN 437 Query: 273 STAMRMAKVLEAH 311 STA RMA++LEAH Sbjct: 438 STAFRMAEILEAH 450 Score = 74.3 bits (181), Expect = 1e-11 Identities = 35/45 (77%), Positives = 41/45 (91%) Frame = -1 Query: 137 ASSKDIIMAKQQMTGFGGVVSFEVDGDLKTTIKFVDSLKIPYIAP 3 AS + +AK+QMTGFGGVVSFE+DGD++TTIKFVDSLKIPYIAP Sbjct: 462 ASHPEHELAKRQMTGFGGVVSFEIDGDIETTIKFVDSLKIPYIAP 506 >ref|NP_001266947.1| cystathionine gamma-synthase, chloroplastic-like [Fragaria vesca] gi|5804835|emb|CAA04772.2| cystathionine gamma synthase [Fragaria vesca] gi|6012969|emb|CAB57356.1| cystathionine gamma synthase [Fragaria vesca] Length = 545 Score = 125 bits (314), Expect = 5e-27 Identities = 59/73 (80%), Positives = 66/73 (90%) Frame = +3 Query: 93 ASHLLLGHNDVLGGCISGSTKIISEIRNLHHILGGTLNPNAAYLIIRGMKTLHLRVQQQN 272 A+ L GHNDVL GCISGS K++SEIR LHHILGG LNPNAAYLIIRGMKTLH+R+QQQN Sbjct: 359 ATKYLAGHNDVLAGCISGSMKLVSEIRILHHILGGALNPNAAYLIIRGMKTLHIRIQQQN 418 Query: 273 STAMRMAKVLEAH 311 STA+RMAK+LEAH Sbjct: 419 STALRMAKILEAH 431 Score = 72.0 bits (175), Expect = 7e-11 Identities = 32/38 (84%), Positives = 37/38 (97%) Frame = -1 Query: 116 MAKQQMTGFGGVVSFEVDGDLKTTIKFVDSLKIPYIAP 3 +AK+QMTGFGGVVSFE+DGDLK TIKF+D+LKIPYIAP Sbjct: 450 LAKRQMTGFGGVVSFEIDGDLKRTIKFIDALKIPYIAP 487 >emb|CAA64383.1| cystathionine gamma-synthase [Arabidopsis thaliana] Length = 563 Score = 125 bits (314), Expect = 5e-27 Identities = 59/73 (80%), Positives = 66/73 (90%) Frame = +3 Query: 93 ASHLLLGHNDVLGGCISGSTKIISEIRNLHHILGGTLNPNAAYLIIRGMKTLHLRVQQQN 272 A+ + GHNDVL GCI GS K++SEIRNLHH+LGGTLNPNAAYLIIRGMKTLHLRVQQQN Sbjct: 377 ATKYIGGHNDVLAGCICGSLKLVSEIRNLHHVLGGTLNPNAAYLIIRGMKTLHLRVQQQN 436 Query: 273 STAMRMAKVLEAH 311 STA RMA++LEAH Sbjct: 437 STAFRMAEILEAH 449 Score = 73.6 bits (179), Expect = 2e-11 Identities = 33/38 (86%), Positives = 38/38 (100%) Frame = -1 Query: 116 MAKQQMTGFGGVVSFEVDGDLKTTIKFVDSLKIPYIAP 3 +AK+QMTGFGGVVSFE+DGD++TTIKFVDSLKIPYIAP Sbjct: 468 LAKRQMTGFGGVVSFEIDGDIETTIKFVDSLKIPYIAP 505 >ref|XP_006297283.1| hypothetical protein CARUB_v10013298mg, partial [Capsella rubella] gi|482565992|gb|EOA30181.1| hypothetical protein CARUB_v10013298mg, partial [Capsella rubella] Length = 589 Score = 125 bits (313), Expect = 7e-27 Identities = 58/73 (79%), Positives = 66/73 (90%) Frame = +3 Query: 93 ASHLLLGHNDVLGGCISGSTKIISEIRNLHHILGGTLNPNAAYLIIRGMKTLHLRVQQQN 272 A+ + GHNDVLGGCI G K++SEIRNLHH+LGGTLNPNAAYLIIRGMKT+HLRVQQQN Sbjct: 403 ATKYIGGHNDVLGGCICGPLKLVSEIRNLHHVLGGTLNPNAAYLIIRGMKTMHLRVQQQN 462 Query: 273 STAMRMAKVLEAH 311 STA RMA++LEAH Sbjct: 463 STAFRMAEILEAH 475 Score = 71.2 bits (173), Expect = 1e-10 Identities = 32/38 (84%), Positives = 37/38 (97%) Frame = -1 Query: 116 MAKQQMTGFGGVVSFEVDGDLKTTIKFVDSLKIPYIAP 3 +AK+QMTGFGGVVSFE+DGD++ TIKFVDSLKIPYIAP Sbjct: 494 LAKRQMTGFGGVVSFEIDGDIERTIKFVDSLKIPYIAP 531 >gb|EMJ17201.1| hypothetical protein PRUPE_ppa004232mg [Prunus persica] Length = 522 Score = 124 bits (312), Expect = 9e-27 Identities = 60/73 (82%), Positives = 65/73 (89%) Frame = +3 Query: 93 ASHLLLGHNDVLGGCISGSTKIISEIRNLHHILGGTLNPNAAYLIIRGMKTLHLRVQQQN 272 A+ + GHNDVL GCISGS K++SEIR LHHILGG LNPNAAYLIIRGMKTLHLRVQQQN Sbjct: 336 ATKYIGGHNDVLAGCISGSLKLVSEIRTLHHILGGALNPNAAYLIIRGMKTLHLRVQQQN 395 Query: 273 STAMRMAKVLEAH 311 STA RMAK+LEAH Sbjct: 396 STASRMAKILEAH 408 Score = 71.2 bits (173), Expect = 1e-10 Identities = 32/38 (84%), Positives = 37/38 (97%) Frame = -1 Query: 116 MAKQQMTGFGGVVSFEVDGDLKTTIKFVDSLKIPYIAP 3 +AK+QMTGFGGVVSFE+DGDL TTIKFVD+L+IPYIAP Sbjct: 427 LAKRQMTGFGGVVSFEIDGDLMTTIKFVDALRIPYIAP 464 >gb|ESW11529.1| hypothetical protein PHAVU_008G038100g [Phaseolus vulgaris] Length = 540 Score = 124 bits (310), Expect = 2e-26 Identities = 57/67 (85%), Positives = 63/67 (94%) Frame = +3 Query: 111 GHNDVLGGCISGSTKIISEIRNLHHILGGTLNPNAAYLIIRGMKTLHLRVQQQNSTAMRM 290 GH+DVLGGCISGSTK++S+IR HHILGGTLNPNAAYL+IRGMKTLHLRVQQQNST M M Sbjct: 360 GHHDVLGGCISGSTKVVSQIRTFHHILGGTLNPNAAYLLIRGMKTLHLRVQQQNSTGMGM 419 Query: 291 AKVLEAH 311 AK+LEAH Sbjct: 420 AKILEAH 426 Score = 70.1 bits (170), Expect = 3e-10 Identities = 32/37 (86%), Positives = 36/37 (97%) Frame = -1 Query: 116 MAKQQMTGFGGVVSFEVDGDLKTTIKFVDSLKIPYIA 6 +AK+QMTGFGGVVSFE+DGD+ TTIKFVDSLKIPYIA Sbjct: 445 LAKRQMTGFGGVVSFEIDGDIHTTIKFVDSLKIPYIA 481