BLASTX nr result
ID: Jatropha_contig00019341
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Jatropha_contig00019341 (570 letters) Database: NCBI-nr (updated 2014/02/11) 35,149,712 sequences; 12,374,887,350 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002519443.1| conserved hypothetical protein [Ricinus comm... 60 3e-07 >ref|XP_002519443.1| conserved hypothetical protein [Ricinus communis] gi|223541306|gb|EEF42857.1| conserved hypothetical protein [Ricinus communis] Length = 1722 Score = 60.5 bits (145), Expect = 3e-07 Identities = 28/33 (84%), Positives = 28/33 (84%) Frame = +2 Query: 410 VCRCISELCRHRSSTISGMLSEFKARADSPSPE 508 VCRCISELCRHRSS I GMLSE KAR D PSPE Sbjct: 528 VCRCISELCRHRSSNIGGMLSECKARPDIPSPE 560