BLASTX nr result
ID: Jatropha_contig00013463
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Jatropha_contig00013463 (478 letters) Database: NCBI-nr (updated 2014/02/11) 35,149,712 sequences; 12,374,887,350 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value dbj|BAJ53210.1| JHL23C09.2 [Jatropha curcas] 62 7e-08 >dbj|BAJ53210.1| JHL23C09.2 [Jatropha curcas] Length = 274 Score = 62.0 bits (149), Expect = 7e-08 Identities = 33/45 (73%), Positives = 34/45 (75%) Frame = -1 Query: 472 SFVIERIHYSGLVEGPSPSGCHSYFAAL*PYPVSRAEDLDHTSVC 338 SFVIERIHYSGLVEG SG SY AL P+ VS AEDLDHT VC Sbjct: 230 SFVIERIHYSGLVEGSPLSGRCSYPFALQPFSVSYAEDLDHTPVC 274