BLASTX nr result
ID: Jatropha_contig00012397
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Jatropha_contig00012397 (479 letters) Database: NCBI-nr (updated 2014/02/11) 35,149,712 sequences; 12,374,887,350 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CBI40274.3| unnamed protein product [Vitis vinifera] 62 7e-08 emb|CAN60920.1| hypothetical protein VITISV_019335 [Vitis vinifera] 62 7e-08 gb|EOX98336.1| Cyclase family protein isoform 1 [Theobroma cacao... 62 1e-07 ref|XP_004304035.1| PREDICTED: kynurenine formamidase-like [Frag... 62 1e-07 gb|EEE85037.2| cyclase family protein [Populus trichocarpa] 61 1e-07 ref|XP_004304036.1| PREDICTED: kynurenine formamidase-like [Frag... 61 1e-07 ref|XP_002300232.1| predicted protein [Populus trichocarpa] 61 1e-07 gb|EMJ02508.1| hypothetical protein PRUPE_ppa009953mg [Prunus pe... 61 2e-07 gb|AFK40095.1| unknown [Medicago truncatula] 61 2e-07 ref|XP_002300230.1| predicted protein [Populus trichocarpa] gi|2... 61 2e-07 ref|XP_006356494.1| PREDICTED: uncharacterized protein LOC102591... 60 3e-07 gb|ERP56982.1| hypothetical protein POPTR_0009s10010g [Populus t... 60 3e-07 ref|XP_002300231.1| predicted protein [Populus trichocarpa] 60 3e-07 gb|ABK95930.1| unknown [Populus trichocarpa] gi|550348587|gb|ERP... 60 3e-07 ref|XP_004136964.1| PREDICTED: kynurenine formamidase-like [Cucu... 60 4e-07 gb|EPS59800.1| hypothetical protein M569_15006 [Genlisea aurea] 59 6e-07 ref|XP_006346376.1| PREDICTED: uncharacterized protein LOC102579... 59 8e-07 ref|XP_006346374.1| PREDICTED: uncharacterized protein LOC102579... 59 8e-07 ref|XP_004230744.1| PREDICTED: kynurenine formamidase-like [Sola... 59 8e-07 ref|XP_002518692.1| conserved hypothetical protein [Ricinus comm... 59 8e-07 >emb|CBI40274.3| unnamed protein product [Vitis vinifera] Length = 173 Score = 62.0 bits (149), Expect = 7e-08 Identities = 28/30 (93%), Positives = 28/30 (93%) Frame = -3 Query: 477 DITPGIYSVHCLPLRLLGAEGSPIRCILIK 388 DI PGIYSVHCLPLRL GAEGSPIRCILIK Sbjct: 143 DIKPGIYSVHCLPLRLFGAEGSPIRCILIK 172 >emb|CAN60920.1| hypothetical protein VITISV_019335 [Vitis vinifera] Length = 246 Score = 62.0 bits (149), Expect = 7e-08 Identities = 28/30 (93%), Positives = 28/30 (93%) Frame = -3 Query: 477 DITPGIYSVHCLPLRLLGAEGSPIRCILIK 388 DI PGIYSVHCLPLRL GAEGSPIRCILIK Sbjct: 216 DIKPGIYSVHCLPLRLFGAEGSPIRCILIK 245 >gb|EOX98336.1| Cyclase family protein isoform 1 [Theobroma cacao] gi|508706441|gb|EOX98337.1| Cyclase family protein isoform 1 [Theobroma cacao] Length = 270 Score = 61.6 bits (148), Expect = 1e-07 Identities = 28/30 (93%), Positives = 28/30 (93%) Frame = -3 Query: 477 DITPGIYSVHCLPLRLLGAEGSPIRCILIK 388 DI PGIYSVHCLPLRLLGAEGSP RCILIK Sbjct: 241 DILPGIYSVHCLPLRLLGAEGSPTRCILIK 270 >ref|XP_004304035.1| PREDICTED: kynurenine formamidase-like [Fragaria vesca subsp. vesca] Length = 271 Score = 61.6 bits (148), Expect = 1e-07 Identities = 28/30 (93%), Positives = 28/30 (93%) Frame = -3 Query: 477 DITPGIYSVHCLPLRLLGAEGSPIRCILIK 388 DI PGIYSVHCLPLRL GAEGSPIRCILIK Sbjct: 242 DIQPGIYSVHCLPLRLTGAEGSPIRCILIK 271 >gb|EEE85037.2| cyclase family protein [Populus trichocarpa] Length = 274 Score = 61.2 bits (147), Expect = 1e-07 Identities = 26/30 (86%), Positives = 28/30 (93%) Frame = -3 Query: 477 DITPGIYSVHCLPLRLLGAEGSPIRCILIK 388 DI PG+YSVHCLPLRL GAEGSPIRC+LIK Sbjct: 245 DIQPGVYSVHCLPLRLFGAEGSPIRCVLIK 274 >ref|XP_004304036.1| PREDICTED: kynurenine formamidase-like [Fragaria vesca subsp. vesca] Length = 275 Score = 61.2 bits (147), Expect = 1e-07 Identities = 28/30 (93%), Positives = 28/30 (93%) Frame = -3 Query: 477 DITPGIYSVHCLPLRLLGAEGSPIRCILIK 388 DI PGIYSVHCLPLRL GAEGSPIRCILIK Sbjct: 246 DIQPGIYSVHCLPLRLQGAEGSPIRCILIK 275 >ref|XP_002300232.1| predicted protein [Populus trichocarpa] Length = 268 Score = 61.2 bits (147), Expect = 1e-07 Identities = 26/30 (86%), Positives = 28/30 (93%) Frame = -3 Query: 477 DITPGIYSVHCLPLRLLGAEGSPIRCILIK 388 DI PG+YSVHCLPLRL GAEGSPIRC+LIK Sbjct: 239 DIQPGVYSVHCLPLRLFGAEGSPIRCVLIK 268 >gb|EMJ02508.1| hypothetical protein PRUPE_ppa009953mg [Prunus persica] Length = 270 Score = 60.8 bits (146), Expect = 2e-07 Identities = 28/30 (93%), Positives = 28/30 (93%) Frame = -3 Query: 477 DITPGIYSVHCLPLRLLGAEGSPIRCILIK 388 DI PGIYSVHCLPLRL GAEGSPIRCILIK Sbjct: 241 DIQPGIYSVHCLPLRLPGAEGSPIRCILIK 270 >gb|AFK40095.1| unknown [Medicago truncatula] Length = 254 Score = 60.8 bits (146), Expect = 2e-07 Identities = 27/30 (90%), Positives = 28/30 (93%) Frame = -3 Query: 477 DITPGIYSVHCLPLRLLGAEGSPIRCILIK 388 DI PG+YSVHCLPLRL GAEGSPIRCILIK Sbjct: 224 DIPPGLYSVHCLPLRLAGAEGSPIRCILIK 253 >ref|XP_002300230.1| predicted protein [Populus trichocarpa] gi|222847488|gb|EEE85035.1| hypothetical protein POPTR_0001s30910g [Populus trichocarpa] Length = 270 Score = 60.8 bits (146), Expect = 2e-07 Identities = 27/30 (90%), Positives = 28/30 (93%) Frame = -3 Query: 477 DITPGIYSVHCLPLRLLGAEGSPIRCILIK 388 DI PGIYS+HCLPLRLLGAE SPIRCILIK Sbjct: 241 DIQPGIYSIHCLPLRLLGAEASPIRCILIK 270 >ref|XP_006356494.1| PREDICTED: uncharacterized protein LOC102591479, partial [Solanum tuberosum] Length = 265 Score = 60.1 bits (144), Expect = 3e-07 Identities = 25/30 (83%), Positives = 29/30 (96%) Frame = -3 Query: 477 DITPGIYSVHCLPLRLLGAEGSPIRCILIK 388 DI PGIY+VHCLPLR+LGAEGSP+RCI+IK Sbjct: 236 DIEPGIYTVHCLPLRMLGAEGSPVRCIVIK 265 >gb|ERP56982.1| hypothetical protein POPTR_0009s10010g [Populus trichocarpa] Length = 189 Score = 60.1 bits (144), Expect = 3e-07 Identities = 25/30 (83%), Positives = 28/30 (93%) Frame = -3 Query: 477 DITPGIYSVHCLPLRLLGAEGSPIRCILIK 388 DI PG+YS+HCLPLR+LGAEGSP RCILIK Sbjct: 160 DIQPGVYSIHCLPLRILGAEGSPTRCILIK 189 >ref|XP_002300231.1| predicted protein [Populus trichocarpa] Length = 204 Score = 60.1 bits (144), Expect = 3e-07 Identities = 25/30 (83%), Positives = 28/30 (93%) Frame = -3 Query: 477 DITPGIYSVHCLPLRLLGAEGSPIRCILIK 388 DI PG+YS+HCLP+RLLGAEGSP RCILIK Sbjct: 175 DIQPGVYSIHCLPIRLLGAEGSPTRCILIK 204 >gb|ABK95930.1| unknown [Populus trichocarpa] gi|550348587|gb|ERP66321.1| hypothetical protein POPTR_0001s30900g [Populus trichocarpa] gi|550348588|gb|EEE85036.2| hypothetical protein POPTR_0001s30900g [Populus trichocarpa] Length = 269 Score = 60.1 bits (144), Expect = 3e-07 Identities = 25/30 (83%), Positives = 28/30 (93%) Frame = -3 Query: 477 DITPGIYSVHCLPLRLLGAEGSPIRCILIK 388 DI PG+YS+HCLP+RLLGAEGSP RCILIK Sbjct: 240 DIQPGVYSIHCLPIRLLGAEGSPTRCILIK 269 >ref|XP_004136964.1| PREDICTED: kynurenine formamidase-like [Cucumis sativus] Length = 272 Score = 59.7 bits (143), Expect = 4e-07 Identities = 25/29 (86%), Positives = 28/29 (96%) Frame = -3 Query: 474 ITPGIYSVHCLPLRLLGAEGSPIRCILIK 388 + PG+YS+HCLPLRLLGAEGSPIRCILIK Sbjct: 244 VQPGLYSIHCLPLRLLGAEGSPIRCILIK 272 >gb|EPS59800.1| hypothetical protein M569_15006 [Genlisea aurea] Length = 286 Score = 58.9 bits (141), Expect = 6e-07 Identities = 26/28 (92%), Positives = 27/28 (96%) Frame = -3 Query: 474 ITPGIYSVHCLPLRLLGAEGSPIRCILI 391 + PGIYSVHCLPLRLLGAEGSPIRCILI Sbjct: 257 VRPGIYSVHCLPLRLLGAEGSPIRCILI 284 >ref|XP_006346376.1| PREDICTED: uncharacterized protein LOC102579417 isoform X3 [Solanum tuberosum] Length = 276 Score = 58.5 bits (140), Expect = 8e-07 Identities = 26/30 (86%), Positives = 28/30 (93%) Frame = -3 Query: 477 DITPGIYSVHCLPLRLLGAEGSPIRCILIK 388 DI G+Y+VHCLPLRLLGAEGSPIRCILIK Sbjct: 247 DIEAGLYTVHCLPLRLLGAEGSPIRCILIK 276 >ref|XP_006346374.1| PREDICTED: uncharacterized protein LOC102579417 isoform X1 [Solanum tuberosum] gi|565359139|ref|XP_006346375.1| PREDICTED: uncharacterized protein LOC102579417 isoform X2 [Solanum tuberosum] Length = 282 Score = 58.5 bits (140), Expect = 8e-07 Identities = 26/30 (86%), Positives = 28/30 (93%) Frame = -3 Query: 477 DITPGIYSVHCLPLRLLGAEGSPIRCILIK 388 DI G+Y+VHCLPLRLLGAEGSPIRCILIK Sbjct: 253 DIEAGLYTVHCLPLRLLGAEGSPIRCILIK 282 >ref|XP_004230744.1| PREDICTED: kynurenine formamidase-like [Solanum lycopersicum] Length = 282 Score = 58.5 bits (140), Expect = 8e-07 Identities = 26/30 (86%), Positives = 28/30 (93%) Frame = -3 Query: 477 DITPGIYSVHCLPLRLLGAEGSPIRCILIK 388 DI G+Y+VHCLPLRLLGAEGSPIRCILIK Sbjct: 253 DIEAGLYTVHCLPLRLLGAEGSPIRCILIK 282 >ref|XP_002518692.1| conserved hypothetical protein [Ricinus communis] gi|223542073|gb|EEF43617.1| conserved hypothetical protein [Ricinus communis] Length = 274 Score = 58.5 bits (140), Expect = 8e-07 Identities = 27/30 (90%), Positives = 28/30 (93%) Frame = -3 Query: 477 DITPGIYSVHCLPLRLLGAEGSPIRCILIK 388 +I GIYSVHCLPLRLLGAEGSPIRCILIK Sbjct: 245 NIQAGIYSVHCLPLRLLGAEGSPIRCILIK 274