BLASTX nr result
ID: Jatropha_contig00004900
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Jatropha_contig00004900 (260 letters) Database: NCBI-nr (updated 2014/02/11) 35,149,712 sequences; 12,374,887,350 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EEF04428.2| hypothetical protein POPTR_0016s04670g [Populus t... 76 5e-12 gb|ERP51536.1| hypothetical protein POPTR_0016s04570g [Populus t... 76 5e-12 ref|XP_002322667.1| predicted protein [Populus trichocarpa] 76 5e-12 gb|AFN53709.1| hypothetical protein [Linum usitatissimum] 74 2e-11 >gb|EEF04428.2| hypothetical protein POPTR_0016s04670g [Populus trichocarpa] Length = 196 Score = 75.9 bits (185), Expect = 5e-12 Identities = 34/44 (77%), Positives = 37/44 (84%) Frame = +2 Query: 5 GTQQMSAMPGHGTGQPYGGEVDPTGLTRTRPSGLPGDTTGHNPR 136 GT QMSAMPGHGTGQPYGG+V+ G+ RT P GLPGDTTGHN R Sbjct: 124 GTHQMSAMPGHGTGQPYGGQVE-EGVARTHPGGLPGDTTGHNTR 166 >gb|ERP51536.1| hypothetical protein POPTR_0016s04570g [Populus trichocarpa] Length = 208 Score = 75.9 bits (185), Expect = 5e-12 Identities = 34/44 (77%), Positives = 37/44 (84%) Frame = +2 Query: 5 GTQQMSAMPGHGTGQPYGGEVDPTGLTRTRPSGLPGDTTGHNPR 136 GT QMSAMPGHGTGQPYGG+V+ G+ RT P GLPGDTTGHN R Sbjct: 136 GTHQMSAMPGHGTGQPYGGQVE-EGVARTHPGGLPGDTTGHNTR 178 >ref|XP_002322667.1| predicted protein [Populus trichocarpa] Length = 175 Score = 75.9 bits (185), Expect = 5e-12 Identities = 34/44 (77%), Positives = 37/44 (84%) Frame = +2 Query: 5 GTQQMSAMPGHGTGQPYGGEVDPTGLTRTRPSGLPGDTTGHNPR 136 GT QMSAMPGHGTGQPYGG+V+ G+ RT P GLPGDTTGHN R Sbjct: 103 GTHQMSAMPGHGTGQPYGGQVE-EGVARTHPGGLPGDTTGHNTR 145 >gb|AFN53709.1| hypothetical protein [Linum usitatissimum] Length = 163 Score = 73.6 bits (179), Expect = 2e-11 Identities = 35/54 (64%), Positives = 37/54 (68%) Frame = +2 Query: 5 GTQQMSAMPGHGTGQPYGGEVDPTGLTRTRPSGLPGDTTGHNPRV*GMACALAP 166 GT QMSAMPGHGTGQPYGG VD G+ R PSGLPG+ TGHN R G P Sbjct: 110 GTHQMSAMPGHGTGQPYGGHVD-EGVARVHPSGLPGEQTGHNTRTGGTGTGHLP 162