BLASTX nr result
ID: Jatropha_contig00000053
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Jatropha_contig00000053 (435 letters) Database: NCBI-nr (updated 2014/02/11) 35,149,712 sequences; 12,374,887,350 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002514906.1| protein with unknown function [Ricinus commu... 62 1e-07 gb|EOX99825.1| Ran BP2/NZF zinc finger-like superfamily protein ... 60 2e-07 gb|EOX99824.1| Ran BP2/NZF zinc finger-like superfamily protein ... 60 2e-07 gb|EOX99822.1| Ran BP2/NZF zinc finger-like superfamily protein ... 60 2e-07 gb|EOX99821.1| Ran BP2/NZF zinc finger-like superfamily protein ... 60 3e-07 gb|EMJ23305.1| hypothetical protein PRUPE_ppa009603mg [Prunus pe... 59 6e-07 ref|XP_004135329.1| PREDICTED: ranBP2-type zinc finger protein A... 59 8e-07 ref|XP_006352183.1| PREDICTED: ranBP2-type zinc finger protein A... 58 1e-06 gb|ERP65454.1| hypothetical protein POPTR_0001s13880g [Populus t... 58 1e-06 gb|EEE84110.2| hypothetical protein POPTR_0001s13880g [Populus t... 58 1e-06 gb|ERP65453.1| hypothetical protein POPTR_0001s13880g [Populus t... 58 1e-06 ref|XP_004239216.1| PREDICTED: ranBP2-type zinc finger protein A... 58 1e-06 ref|XP_004239215.1| PREDICTED: ranBP2-type zinc finger protein A... 58 1e-06 ref|XP_003551204.1| PREDICTED: ranBP2-type zinc finger protein A... 58 1e-06 ref|XP_002299305.1| predicted protein [Populus trichocarpa] 58 1e-06 emb|CBI27663.3| unnamed protein product [Vitis vinifera] 57 2e-06 ref|XP_002277426.1| PREDICTED: ranBP2-type zinc finger protein A... 57 2e-06 gb|ESW35764.1| hypothetical protein PHAVU_001G262500g [Phaseolus... 57 3e-06 >ref|XP_002514906.1| protein with unknown function [Ricinus communis] gi|223545957|gb|EEF47460.1| protein with unknown function [Ricinus communis] Length = 286 Score = 61.6 bits (148), Expect = 1e-07 Identities = 26/30 (86%), Positives = 28/30 (93%) Frame = +1 Query: 4 RTKCNRQNCGAEKPNESKKSPSPVAEENDQ 93 RTKCNRQNCGAEKP+ESKKSPSP +ENDQ Sbjct: 257 RTKCNRQNCGAEKPDESKKSPSPATDENDQ 286 >gb|EOX99825.1| Ran BP2/NZF zinc finger-like superfamily protein isoform 5, partial [Theobroma cacao] Length = 293 Score = 60.5 bits (145), Expect = 2e-07 Identities = 27/35 (77%), Positives = 29/35 (82%) Frame = +1 Query: 4 RTKCNRQNCGAEKPNESKKSPSPVAEENDQ*VLGH 108 RTKCNRQNCGA+KP ESKKSPSP A ENDQ + H Sbjct: 256 RTKCNRQNCGADKPAESKKSPSPTANENDQCYMLH 290 >gb|EOX99824.1| Ran BP2/NZF zinc finger-like superfamily protein isoform 4, partial [Theobroma cacao] Length = 295 Score = 60.5 bits (145), Expect = 2e-07 Identities = 27/35 (77%), Positives = 29/35 (82%) Frame = +1 Query: 4 RTKCNRQNCGAEKPNESKKSPSPVAEENDQ*VLGH 108 RTKCNRQNCGA+KP ESKKSPSP A ENDQ + H Sbjct: 258 RTKCNRQNCGADKPAESKKSPSPTANENDQCYMLH 292 >gb|EOX99822.1| Ran BP2/NZF zinc finger-like superfamily protein isoform 2 [Theobroma cacao] Length = 308 Score = 60.5 bits (145), Expect = 2e-07 Identities = 27/35 (77%), Positives = 29/35 (82%) Frame = +1 Query: 4 RTKCNRQNCGAEKPNESKKSPSPVAEENDQ*VLGH 108 RTKCNRQNCGA+KP ESKKSPSP A ENDQ + H Sbjct: 256 RTKCNRQNCGADKPAESKKSPSPTANENDQCYMLH 290 >gb|EOX99821.1| Ran BP2/NZF zinc finger-like superfamily protein isoform 1 [Theobroma cacao] gi|508707927|gb|EOX99823.1| Ran BP2/NZF zinc finger-like superfamily protein isoform 1 [Theobroma cacao] Length = 285 Score = 60.1 bits (144), Expect = 3e-07 Identities = 26/30 (86%), Positives = 27/30 (90%) Frame = +1 Query: 4 RTKCNRQNCGAEKPNESKKSPSPVAEENDQ 93 RTKCNRQNCGA+KP ESKKSPSP A ENDQ Sbjct: 256 RTKCNRQNCGADKPAESKKSPSPTANENDQ 285 >gb|EMJ23305.1| hypothetical protein PRUPE_ppa009603mg [Prunus persica] Length = 285 Score = 58.9 bits (141), Expect = 6e-07 Identities = 25/30 (83%), Positives = 27/30 (90%) Frame = +1 Query: 4 RTKCNRQNCGAEKPNESKKSPSPVAEENDQ 93 RTKCNRQNCGA+KP ESKKSPSP +ENDQ Sbjct: 256 RTKCNRQNCGADKPAESKKSPSPAPDENDQ 285 >ref|XP_004135329.1| PREDICTED: ranBP2-type zinc finger protein At1g67325-like [Cucumis sativus] gi|449494955|ref|XP_004159694.1| PREDICTED: ranBP2-type zinc finger protein At1g67325-like [Cucumis sativus] Length = 285 Score = 58.5 bits (140), Expect = 8e-07 Identities = 25/30 (83%), Positives = 27/30 (90%) Frame = +1 Query: 4 RTKCNRQNCGAEKPNESKKSPSPVAEENDQ 93 RTKCNRQNCGA+KP ES+KSPSP EENDQ Sbjct: 256 RTKCNRQNCGADKPAESEKSPSPAQEENDQ 285 >ref|XP_006352183.1| PREDICTED: ranBP2-type zinc finger protein At1g67325-like [Solanum tuberosum] Length = 281 Score = 58.2 bits (139), Expect = 1e-06 Identities = 25/30 (83%), Positives = 28/30 (93%) Frame = +1 Query: 4 RTKCNRQNCGAEKPNESKKSPSPVAEENDQ 93 RTKCNRQNCGAEKP+E+KKSPS A+ENDQ Sbjct: 252 RTKCNRQNCGAEKPSEAKKSPSQSADENDQ 281 >gb|ERP65454.1| hypothetical protein POPTR_0001s13880g [Populus trichocarpa] Length = 291 Score = 58.2 bits (139), Expect = 1e-06 Identities = 25/30 (83%), Positives = 27/30 (90%) Frame = +1 Query: 4 RTKCNRQNCGAEKPNESKKSPSPVAEENDQ 93 RTKCNRQNCGAEKP ESKKSPSP +E+DQ Sbjct: 255 RTKCNRQNCGAEKPAESKKSPSPAPDEDDQ 284 >gb|EEE84110.2| hypothetical protein POPTR_0001s13880g [Populus trichocarpa] Length = 287 Score = 58.2 bits (139), Expect = 1e-06 Identities = 25/30 (83%), Positives = 27/30 (90%) Frame = +1 Query: 4 RTKCNRQNCGAEKPNESKKSPSPVAEENDQ 93 RTKCNRQNCGAEKP ESKKSPSP +E+DQ Sbjct: 251 RTKCNRQNCGAEKPAESKKSPSPAPDEDDQ 280 >gb|ERP65453.1| hypothetical protein POPTR_0001s13880g [Populus trichocarpa] Length = 284 Score = 58.2 bits (139), Expect = 1e-06 Identities = 25/30 (83%), Positives = 27/30 (90%) Frame = +1 Query: 4 RTKCNRQNCGAEKPNESKKSPSPVAEENDQ 93 RTKCNRQNCGAEKP ESKKSPSP +E+DQ Sbjct: 255 RTKCNRQNCGAEKPAESKKSPSPAPDEDDQ 284 >ref|XP_004239216.1| PREDICTED: ranBP2-type zinc finger protein At1g67325-like isoform 2 [Solanum lycopersicum] Length = 281 Score = 58.2 bits (139), Expect = 1e-06 Identities = 25/30 (83%), Positives = 28/30 (93%) Frame = +1 Query: 4 RTKCNRQNCGAEKPNESKKSPSPVAEENDQ 93 RTKCNRQNCGAEKP+E+KKSPS A+ENDQ Sbjct: 252 RTKCNRQNCGAEKPSEAKKSPSQSADENDQ 281 >ref|XP_004239215.1| PREDICTED: ranBP2-type zinc finger protein At1g67325-like isoform 1 [Solanum lycopersicum] Length = 383 Score = 58.2 bits (139), Expect = 1e-06 Identities = 25/30 (83%), Positives = 28/30 (93%) Frame = +1 Query: 4 RTKCNRQNCGAEKPNESKKSPSPVAEENDQ 93 RTKCNRQNCGAEKP+E+KKSPS A+ENDQ Sbjct: 252 RTKCNRQNCGAEKPSEAKKSPSQSADENDQ 281 >ref|XP_003551204.1| PREDICTED: ranBP2-type zinc finger protein At1g67325-like [Glycine max] Length = 285 Score = 58.2 bits (139), Expect = 1e-06 Identities = 24/30 (80%), Positives = 28/30 (93%) Frame = +1 Query: 4 RTKCNRQNCGAEKPNESKKSPSPVAEENDQ 93 RTKCNRQNCGA+KP ES+KSPSP A++NDQ Sbjct: 256 RTKCNRQNCGADKPAESEKSPSPAADQNDQ 285 >ref|XP_002299305.1| predicted protein [Populus trichocarpa] Length = 278 Score = 58.2 bits (139), Expect = 1e-06 Identities = 25/30 (83%), Positives = 27/30 (90%) Frame = +1 Query: 4 RTKCNRQNCGAEKPNESKKSPSPVAEENDQ 93 RTKCNRQNCGAEKP ESKKSPSP +E+DQ Sbjct: 249 RTKCNRQNCGAEKPAESKKSPSPAPDEDDQ 278 >emb|CBI27663.3| unnamed protein product [Vitis vinifera] Length = 287 Score = 57.0 bits (136), Expect = 2e-06 Identities = 24/30 (80%), Positives = 27/30 (90%) Frame = +1 Query: 4 RTKCNRQNCGAEKPNESKKSPSPVAEENDQ 93 RTKCNRQNCGA+KP+ES KSPSP +ENDQ Sbjct: 253 RTKCNRQNCGADKPSESTKSPSPSPDENDQ 282 >ref|XP_002277426.1| PREDICTED: ranBP2-type zinc finger protein At1g67325-like [Vitis vinifera] Length = 282 Score = 57.0 bits (136), Expect = 2e-06 Identities = 24/30 (80%), Positives = 27/30 (90%) Frame = +1 Query: 4 RTKCNRQNCGAEKPNESKKSPSPVAEENDQ 93 RTKCNRQNCGA+KP+ES KSPSP +ENDQ Sbjct: 253 RTKCNRQNCGADKPSESTKSPSPSPDENDQ 282 >gb|ESW35764.1| hypothetical protein PHAVU_001G262500g [Phaseolus vulgaris] Length = 283 Score = 56.6 bits (135), Expect = 3e-06 Identities = 24/30 (80%), Positives = 27/30 (90%) Frame = +1 Query: 4 RTKCNRQNCGAEKPNESKKSPSPVAEENDQ 93 RTKCNRQNCGA+KP ES KSPSP A++NDQ Sbjct: 254 RTKCNRQNCGADKPAESDKSPSPSADQNDQ 283