BLASTX nr result
ID: Glycyrrhiza36_contig00039284
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza36_contig00039284 (383 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value KVH89542.1 hypothetical protein Ccrd_008468 [Cynara cardunculus ... 104 1e-26 ANS54463.1 dormancy-associated protein 1, partial [Chrysanthemum... 94 1e-22 XP_019170061.1 PREDICTED: dormancy-associated protein 1-like [Ip... 94 3e-22 AAC62104.2 auxin-repressed protein [Elaeagnus umbellata] 94 3e-22 XP_002279836.1 PREDICTED: auxin-repressed 12.5 kDa protein isofo... 94 3e-22 EEF50833.1 Auxin-repressed 12.5 kDa protein, putative [Ricinus c... 93 4e-22 KDP20994.1 hypothetical protein JCGZ_21465 [Jatropha curcas] 92 2e-21 NP_001295697.1 auxin-repressed 12.5 kDa protein [Jatropha curcas... 92 2e-21 XP_019090805.1 PREDICTED: dormancy-associated protein 1-like [Ca... 90 2e-21 AAW02792.1 dormancy-associated protein [Codonopsis lanceolata] 91 3e-21 OMO76398.1 Dormancyauxin associated [Corchorus capsularis] 91 3e-21 KDO77640.1 hypothetical protein CISIN_1g032874mg [Citrus sinensis] 90 3e-21 XP_010111197.1 hypothetical protein L484_015082 [Morus notabilis... 91 3e-21 XP_002881308.1 dormancy/auxin associated family protein [Arabido... 91 4e-21 ADO32740.1 auxin-repressed protein [Camellia sinensis] 91 5e-21 AAX84678.1 auxin-repressed protein-like protein ARP2, partial [M... 89 5e-21 XP_002509446.2 PREDICTED: histone H3.v1 isoform X6 [Ricinus comm... 93 5e-21 XP_006410531.1 hypothetical protein EUTSA_v10017461mg [Eutrema s... 90 5e-21 KDO77639.1 hypothetical protein CISIN_1g032874mg [Citrus sinensis] 90 6e-21 XP_010499356.1 PREDICTED: dormancy-associated protein 1 isoform ... 90 7e-21 >KVH89542.1 hypothetical protein Ccrd_008468 [Cynara cardunculus var. scolymus] Length = 123 Score = 104 bits (260), Expect = 1e-26 Identities = 47/51 (92%), Positives = 48/51 (94%) Frame = -1 Query: 383 RKDNVWRSVFNPGSNLATKGGGSNYFDKPSTVGSPTVYDWLYSGETRSKHR 231 RKDNVWRSVFNPGSNLATKG GSNYFD P +VGSPTVYDWLYSGETRSKHR Sbjct: 73 RKDNVWRSVFNPGSNLATKGIGSNYFDSPKSVGSPTVYDWLYSGETRSKHR 123 >ANS54463.1 dormancy-associated protein 1, partial [Chrysanthemum x morifolium] Length = 93 Score = 94.0 bits (232), Expect = 1e-22 Identities = 41/51 (80%), Positives = 44/51 (86%) Frame = -1 Query: 383 RKDNVWRSVFNPGSNLATKGGGSNYFDKPSTVGSPTVYDWLYSGETRSKHR 231 + +NVWRSVFNPGSNLATK GSNYFD P GSPTVYDWLYSG+TRSKHR Sbjct: 43 KAENVWRSVFNPGSNLATKSVGSNYFDSPKHAGSPTVYDWLYSGDTRSKHR 93 >XP_019170061.1 PREDICTED: dormancy-associated protein 1-like [Ipomoea nil] Length = 117 Score = 93.6 bits (231), Expect = 3e-22 Identities = 42/51 (82%), Positives = 43/51 (84%) Frame = -1 Query: 383 RKDNVWRSVFNPGSNLATKGGGSNYFDKPSTVGSPTVYDWLYSGETRSKHR 231 RKDNVWRSVFNPGSNLATK G+ FDKP SPTVYDWLYSGETRSKHR Sbjct: 67 RKDNVWRSVFNPGSNLATKNIGAQVFDKPKNTNSPTVYDWLYSGETRSKHR 117 >AAC62104.2 auxin-repressed protein [Elaeagnus umbellata] Length = 120 Score = 93.6 bits (231), Expect = 3e-22 Identities = 42/51 (82%), Positives = 45/51 (88%) Frame = -1 Query: 383 RKDNVWRSVFNPGSNLATKGGGSNYFDKPSTVGSPTVYDWLYSGETRSKHR 231 RK+NVWRSVFNPGSNLAT+G G+ FDKPS SPTVYDWLYSGETRSKHR Sbjct: 70 RKENVWRSVFNPGSNLATRGLGTEMFDKPSQPNSPTVYDWLYSGETRSKHR 120 >XP_002279836.1 PREDICTED: auxin-repressed 12.5 kDa protein isoform X1 [Vitis vinifera] CAN59795.1 hypothetical protein VITISV_001903 [Vitis vinifera] CBI30595.3 unnamed protein product, partial [Vitis vinifera] ALK27168.1 auxin-repressed protein [Vitis vinifera] Length = 121 Score = 93.6 bits (231), Expect = 3e-22 Identities = 41/50 (82%), Positives = 46/50 (92%) Frame = -1 Query: 383 RKDNVWRSVFNPGSNLATKGGGSNYFDKPSTVGSPTVYDWLYSGETRSKH 234 RKDNVWRSVF+PGSNLATKG GS+YFDKP+ +PTVYDWLYSGETR+KH Sbjct: 70 RKDNVWRSVFHPGSNLATKGMGSDYFDKPTKKDTPTVYDWLYSGETRTKH 119 >EEF50833.1 Auxin-repressed 12.5 kDa protein, putative [Ricinus communis] Length = 118 Score = 93.2 bits (230), Expect = 4e-22 Identities = 42/51 (82%), Positives = 45/51 (88%) Frame = -1 Query: 383 RKDNVWRSVFNPGSNLATKGGGSNYFDKPSTVGSPTVYDWLYSGETRSKHR 231 RKDNVWRSVF+PGSNLAT+G G+ FDKPS SPTVYDWLYSGETRSKHR Sbjct: 68 RKDNVWRSVFHPGSNLATRGIGAQLFDKPSQPNSPTVYDWLYSGETRSKHR 118 >KDP20994.1 hypothetical protein JCGZ_21465 [Jatropha curcas] Length = 115 Score = 91.7 bits (226), Expect = 2e-21 Identities = 41/51 (80%), Positives = 44/51 (86%) Frame = -1 Query: 383 RKDNVWRSVFNPGSNLATKGGGSNYFDKPSTVGSPTVYDWLYSGETRSKHR 231 RKDNVWRSVF+PGSNLATKG G+ FDKP SPTVYDWLYSG+TRSKHR Sbjct: 65 RKDNVWRSVFHPGSNLATKGLGAQLFDKPQQPNSPTVYDWLYSGDTRSKHR 115 >NP_001295697.1 auxin-repressed 12.5 kDa protein [Jatropha curcas] ADB02903.1 auxin-repressed protein-like protein ARP1 [Jatropha curcas] Length = 120 Score = 91.7 bits (226), Expect = 2e-21 Identities = 41/51 (80%), Positives = 44/51 (86%) Frame = -1 Query: 383 RKDNVWRSVFNPGSNLATKGGGSNYFDKPSTVGSPTVYDWLYSGETRSKHR 231 RKDNVWRSVF+PGSNLATKG G+ FDKP SPTVYDWLYSG+TRSKHR Sbjct: 70 RKDNVWRSVFHPGSNLATKGLGAQLFDKPQQPNSPTVYDWLYSGDTRSKHR 120 >XP_019090805.1 PREDICTED: dormancy-associated protein 1-like [Camelina sativa] Length = 76 Score = 90.1 bits (222), Expect = 2e-21 Identities = 40/51 (78%), Positives = 45/51 (88%) Frame = -1 Query: 383 RKDNVWRSVFNPGSNLATKGGGSNYFDKPSTVGSPTVYDWLYSGETRSKHR 231 RKDNVWRSVFNPGSNLAT+ GSN FDKP+ SP+VYDWLYSGE+RS+HR Sbjct: 26 RKDNVWRSVFNPGSNLATRAIGSNIFDKPTHPNSPSVYDWLYSGESRSQHR 76 >AAW02792.1 dormancy-associated protein [Codonopsis lanceolata] Length = 119 Score = 91.3 bits (225), Expect = 3e-21 Identities = 44/51 (86%), Positives = 44/51 (86%) Frame = -1 Query: 383 RKDNVWRSVFNPGSNLATKGGGSNYFDKPSTVGSPTVYDWLYSGETRSKHR 231 RKDNVWRSVFNPGSNLATKG GS FDKP SPTVYDWLYSGETRSKHR Sbjct: 70 RKDNVWRSVFNPGSNLATKGLGSALFDKPEP-NSPTVYDWLYSGETRSKHR 119 >OMO76398.1 Dormancyauxin associated [Corchorus capsularis] Length = 121 Score = 91.3 bits (225), Expect = 3e-21 Identities = 41/50 (82%), Positives = 44/50 (88%) Frame = -1 Query: 383 RKDNVWRSVFNPGSNLATKGGGSNYFDKPSTVGSPTVYDWLYSGETRSKH 234 R+DNVWRSVF+PGSNLATKG G+ FDKPS SPTVYDWLYSGETRSKH Sbjct: 70 RRDNVWRSVFHPGSNLATKGIGAAVFDKPSQANSPTVYDWLYSGETRSKH 119 >KDO77640.1 hypothetical protein CISIN_1g032874mg [Citrus sinensis] Length = 72 Score = 89.7 bits (221), Expect = 3e-21 Identities = 40/50 (80%), Positives = 44/50 (88%) Frame = -1 Query: 383 RKDNVWRSVFNPGSNLATKGGGSNYFDKPSTVGSPTVYDWLYSGETRSKH 234 RKDNVWRSVF+PGSNLAT+G G+ FDKP+ SPTVYDWLYSGETRSKH Sbjct: 21 RKDNVWRSVFHPGSNLATRGIGAEVFDKPTHPNSPTVYDWLYSGETRSKH 70 >XP_010111197.1 hypothetical protein L484_015082 [Morus notabilis] EXC30588.1 hypothetical protein L484_015082 [Morus notabilis] Length = 124 Score = 91.3 bits (225), Expect = 3e-21 Identities = 41/51 (80%), Positives = 45/51 (88%) Frame = -1 Query: 383 RKDNVWRSVFNPGSNLATKGGGSNYFDKPSTVGSPTVYDWLYSGETRSKHR 231 RKDNVWRSVF+PGSNLATKG G+ FDKP + SPTVYDWLYSGETRSKH+ Sbjct: 74 RKDNVWRSVFHPGSNLATKGIGAALFDKPDSPNSPTVYDWLYSGETRSKHQ 124 >XP_002881308.1 dormancy/auxin associated family protein [Arabidopsis lyrata subsp. lyrata] EFH57567.1 dormancy/auxin associated family protein [Arabidopsis lyrata subsp. lyrata] Length = 108 Score = 90.5 bits (223), Expect = 4e-21 Identities = 40/50 (80%), Positives = 44/50 (88%) Frame = -1 Query: 383 RKDNVWRSVFNPGSNLATKGGGSNYFDKPSTVGSPTVYDWLYSGETRSKH 234 RKDNVWRSVF+PGSN+ATKG G+N FDKPS SPTVYDWLYS +TRSKH Sbjct: 58 RKDNVWRSVFHPGSNIATKGRGTNLFDKPSHPNSPTVYDWLYSDDTRSKH 107 >ADO32740.1 auxin-repressed protein [Camellia sinensis] Length = 118 Score = 90.5 bits (223), Expect = 5e-21 Identities = 43/50 (86%), Positives = 44/50 (88%) Frame = -1 Query: 380 KDNVWRSVFNPGSNLATKGGGSNYFDKPSTVGSPTVYDWLYSGETRSKHR 231 KDNVWRSVFNPGSNLATKG GS+ FDKP SPTVYDWLYSGETRSKHR Sbjct: 70 KDNVWRSVFNPGSNLATKGIGSDVFDKPQP-NSPTVYDWLYSGETRSKHR 118 >AAX84678.1 auxin-repressed protein-like protein ARP2, partial [Manihot esculenta] Length = 68 Score = 89.0 bits (219), Expect = 5e-21 Identities = 42/51 (82%), Positives = 44/51 (86%) Frame = -1 Query: 383 RKDNVWRSVFNPGSNLATKGGGSNYFDKPSTVGSPTVYDWLYSGETRSKHR 231 RKDNVWRSVF+PGSNLATKG G+ FDKP SPTVYDWLYSGETRSKHR Sbjct: 19 RKDNVWRSVFHPGSNLATKGLGAQLFDKPQP-NSPTVYDWLYSGETRSKHR 68 >XP_002509446.2 PREDICTED: histone H3.v1 isoform X6 [Ricinus communis] Length = 218 Score = 93.2 bits (230), Expect = 5e-21 Identities = 42/51 (82%), Positives = 45/51 (88%) Frame = -1 Query: 383 RKDNVWRSVFNPGSNLATKGGGSNYFDKPSTVGSPTVYDWLYSGETRSKHR 231 RKDNVWRSVF+PGSNLAT+G G+ FDKPS SPTVYDWLYSGETRSKHR Sbjct: 168 RKDNVWRSVFHPGSNLATRGIGAQLFDKPSQPNSPTVYDWLYSGETRSKHR 218 >XP_006410531.1 hypothetical protein EUTSA_v10017461mg [Eutrema salsugineum] ESQ51984.1 hypothetical protein EUTSA_v10017461mg [Eutrema salsugineum] Length = 108 Score = 90.1 bits (222), Expect = 5e-21 Identities = 40/51 (78%), Positives = 44/51 (86%) Frame = -1 Query: 383 RKDNVWRSVFNPGSNLATKGGGSNYFDKPSTVGSPTVYDWLYSGETRSKHR 231 RKDNVWRSVFNPGSN ATKG G++ FDKPS SPTVYDWLYS +TRS+HR Sbjct: 58 RKDNVWRSVFNPGSNTATKGMGTDLFDKPSHANSPTVYDWLYSDDTRSQHR 108 >KDO77639.1 hypothetical protein CISIN_1g032874mg [Citrus sinensis] Length = 98 Score = 89.7 bits (221), Expect = 6e-21 Identities = 40/50 (80%), Positives = 44/50 (88%) Frame = -1 Query: 383 RKDNVWRSVFNPGSNLATKGGGSNYFDKPSTVGSPTVYDWLYSGETRSKH 234 RKDNVWRSVF+PGSNLAT+G G+ FDKP+ SPTVYDWLYSGETRSKH Sbjct: 47 RKDNVWRSVFHPGSNLATRGIGAEVFDKPTHPNSPTVYDWLYSGETRSKH 96 >XP_010499356.1 PREDICTED: dormancy-associated protein 1 isoform X2 [Camelina sativa] Length = 119 Score = 90.1 bits (222), Expect = 7e-21 Identities = 40/51 (78%), Positives = 45/51 (88%) Frame = -1 Query: 383 RKDNVWRSVFNPGSNLATKGGGSNYFDKPSTVGSPTVYDWLYSGETRSKHR 231 RKDNVWRSVFNPGSNLAT+ GSN FDKP+ SP+VYDWLYSGE+RS+HR Sbjct: 69 RKDNVWRSVFNPGSNLATRAIGSNIFDKPTHPNSPSVYDWLYSGESRSQHR 119