BLASTX nr result
ID: Glycyrrhiza36_contig00038864
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza36_contig00038864 (214 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_004513903.1 PREDICTED: uncharacterized protein LOC101506280 [... 64 2e-10 KRH75849.1 hypothetical protein GLYMA_01G114200 [Glycine max] 52 5e-07 XP_007133920.1 hypothetical protein PHAVU_010G003400g [Phaseolus... 54 9e-07 >XP_004513903.1 PREDICTED: uncharacterized protein LOC101506280 [Cicer arietinum] Length = 239 Score = 63.5 bits (153), Expect = 2e-10 Identities = 34/57 (59%), Positives = 41/57 (71%), Gaps = 2/57 (3%) Frame = +2 Query: 50 PSSNESSRPEQQILEENGI--DLKSLSLKAAEEFSNRPRKGMIYDEITANLESIKIR 214 P+ + EQ LE++GI DLKSLSLKA EE SNRP+ G+IYDE+ ANL SIK R Sbjct: 107 PNQTKHVELEQVFLEQSGIEIDLKSLSLKAEEELSNRPKNGVIYDEVEANLRSIKKR 163 >KRH75849.1 hypothetical protein GLYMA_01G114200 [Glycine max] Length = 92 Score = 52.0 bits (123), Expect = 5e-07 Identities = 26/45 (57%), Positives = 35/45 (77%) Frame = +2 Query: 77 EQQILEENGIDLKSLSLKAAEEFSNRPRKGMIYDEITANLESIKI 211 ++QILE+NGID+KSLSLKA EE S RP+ G IY E+ + +I+I Sbjct: 4 DEQILEQNGIDMKSLSLKAGEERSKRPKNGDIYRELFSIDAAIEI 48 >XP_007133920.1 hypothetical protein PHAVU_010G003400g [Phaseolus vulgaris] ESW05914.1 hypothetical protein PHAVU_010G003400g [Phaseolus vulgaris] Length = 311 Score = 53.9 bits (128), Expect = 9e-07 Identities = 25/47 (53%), Positives = 38/47 (80%) Frame = +2 Query: 74 PEQQILEENGIDLKSLSLKAAEEFSNRPRKGMIYDEITANLESIKIR 214 P++QILEEN I+ K+LSL+AAEE S P+ G IY+E+ A++++I+ R Sbjct: 189 PDEQILEENEIETKALSLRAAEELSKAPKIGEIYNEVEADVKNIEKR 235