BLASTX nr result
ID: Glycyrrhiza36_contig00036697
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza36_contig00036697 (259 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value GAU10686.1 hypothetical protein TSUD_424670, partial [Trifolium ... 52 4e-06 GAU23575.1 hypothetical protein TSUD_385630 [Trifolium subterran... 52 6e-06 GAU23570.1 hypothetical protein TSUD_385560 [Trifolium subterran... 52 6e-06 AAL01006.1 NBS/LRR resistance protein-like protein, partial [The... 51 7e-06 >GAU10686.1 hypothetical protein TSUD_424670, partial [Trifolium subterraneum] Length = 227 Score = 52.4 bits (124), Expect = 4e-06 Identities = 22/39 (56%), Positives = 30/39 (76%) Frame = -1 Query: 163 WVCVSDDI*CLKITETIMKSVTKSTCNINDKNLLHINLK 47 W CVSD K+T+ IM++VT+S CNIN+K LLH++LK Sbjct: 168 WACVSDHFDEFKVTKAIMEAVTRSACNINNKELLHLDLK 206 >GAU23575.1 hypothetical protein TSUD_385630 [Trifolium subterraneum] Length = 627 Score = 52.4 bits (124), Expect = 6e-06 Identities = 22/39 (56%), Positives = 30/39 (76%) Frame = -1 Query: 163 WVCVSDDI*CLKITETIMKSVTKSTCNINDKNLLHINLK 47 W CVSD K+T+ IM++VT+S CNIN+K LLH++LK Sbjct: 230 WACVSDHFDEFKVTKAIMEAVTRSACNINNKELLHLDLK 268 >GAU23570.1 hypothetical protein TSUD_385560 [Trifolium subterraneum] Length = 1236 Score = 52.4 bits (124), Expect = 6e-06 Identities = 22/39 (56%), Positives = 30/39 (76%) Frame = -1 Query: 163 WVCVSDDI*CLKITETIMKSVTKSTCNINDKNLLHINLK 47 W CVSD K+T+ IM++VT+S CNIN+K LLH++LK Sbjct: 227 WACVSDHFDEFKVTKAIMEAVTRSACNINNKELLHLDLK 265 >AAL01006.1 NBS/LRR resistance protein-like protein, partial [Theobroma cacao] Length = 173 Score = 51.2 bits (121), Expect = 7e-06 Identities = 22/39 (56%), Positives = 30/39 (76%) Frame = -1 Query: 163 WVCVSDDI*CLKITETIMKSVTKSTCNINDKNLLHINLK 47 WVCVS++ +KIT+TI++SVT +CN ND NLL + LK Sbjct: 27 WVCVSNEFDVIKITKTILESVTSQSCNKNDLNLLQVELK 65