BLASTX nr result
ID: Glycyrrhiza36_contig00032129
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza36_contig00032129 (210 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value OIW10203.1 hypothetical protein TanjilG_27954 [Lupinus angustifo... 104 2e-26 GAU29091.1 hypothetical protein TSUD_58570 [Trifolium subterraneum] 104 6e-25 XP_019445815.1 PREDICTED: pentatricopeptide repeat-containing pr... 104 1e-24 XP_013456860.1 pentatricopeptide (PPR) repeat protein [Medicago ... 104 2e-24 XP_015950445.1 PREDICTED: pentatricopeptide repeat-containing pr... 103 2e-24 XP_007157720.1 hypothetical protein PHAVU_002G092700g [Phaseolus... 103 4e-24 BAT75171.1 hypothetical protein VIGAN_01299100 [Vigna angularis ... 102 6e-24 KYP42578.1 Pentatricopeptide repeat-containing protein At1g11290... 102 6e-24 KOM32000.1 hypothetical protein LR48_Vigan01g155600 [Vigna angul... 102 6e-24 XP_017425988.1 PREDICTED: pentatricopeptide repeat-containing pr... 102 6e-24 XP_014506168.1 PREDICTED: pentatricopeptide repeat-containing pr... 102 8e-24 XP_016183990.1 PREDICTED: pentatricopeptide repeat-containing pr... 102 1e-23 XP_004505258.1 PREDICTED: pentatricopeptide repeat-containing pr... 101 1e-23 EOY11186.1 Pentatricopeptide repeat superfamily protein [Theobro... 100 4e-23 AFG61376.1 hypothetical protein 0_7614_01, partial [Pinus taeda] 93 5e-23 AEW07637.1 hypothetical protein 0_7614_01, partial [Pinus radiat... 93 5e-23 KHN32251.1 Pentatricopeptide repeat-containing protein [Glycine ... 100 7e-23 XP_003556647.1 PREDICTED: pentatricopeptide repeat-containing pr... 100 7e-23 XP_009342022.1 PREDICTED: pentatricopeptide repeat-containing pr... 99 1e-22 XP_016726350.1 PREDICTED: pentatricopeptide repeat-containing pr... 98 2e-22 >OIW10203.1 hypothetical protein TanjilG_27954 [Lupinus angustifolius] Length = 210 Score = 104 bits (260), Expect = 2e-26 Identities = 46/48 (95%), Positives = 47/48 (97%) Frame = +3 Query: 3 ITKNLRVCVDCHTVTKYISRIVKREIIVRDANRFHHFVNGVCSCNDYW 146 ITKNLRVCVDCHTVTKYIS+IVKREIIVRDANRFHHFVNG CSCNDYW Sbjct: 163 ITKNLRVCVDCHTVTKYISKIVKREIIVRDANRFHHFVNGECSCNDYW 210 >GAU29091.1 hypothetical protein TSUD_58570 [Trifolium subterraneum] Length = 451 Score = 104 bits (260), Expect = 6e-25 Identities = 46/48 (95%), Positives = 47/48 (97%) Frame = +3 Query: 3 ITKNLRVCVDCHTVTKYISRIVKREIIVRDANRFHHFVNGVCSCNDYW 146 ITKNLRVCVDCHTVTKYIS+IVKREIIVRDANRFHHFVNG CSCNDYW Sbjct: 335 ITKNLRVCVDCHTVTKYISKIVKREIIVRDANRFHHFVNGECSCNDYW 382 >XP_019445815.1 PREDICTED: pentatricopeptide repeat-containing protein At3g12770-like [Lupinus angustifolius] Length = 813 Score = 104 bits (260), Expect = 1e-24 Identities = 46/48 (95%), Positives = 47/48 (97%) Frame = +3 Query: 3 ITKNLRVCVDCHTVTKYISRIVKREIIVRDANRFHHFVNGVCSCNDYW 146 ITKNLRVCVDCHTVTKYIS+IVKREIIVRDANRFHHFVNG CSCNDYW Sbjct: 766 ITKNLRVCVDCHTVTKYISKIVKREIIVRDANRFHHFVNGECSCNDYW 813 >XP_013456860.1 pentatricopeptide (PPR) repeat protein [Medicago truncatula] KEH30891.1 pentatricopeptide (PPR) repeat protein [Medicago truncatula] Length = 814 Score = 104 bits (259), Expect = 2e-24 Identities = 45/48 (93%), Positives = 47/48 (97%) Frame = +3 Query: 3 ITKNLRVCVDCHTVTKYISRIVKREIIVRDANRFHHFVNGVCSCNDYW 146 ITKNLR+CVDCHTVTKYIS+IVKREIIVRDANRFHHFVNG CSCNDYW Sbjct: 767 ITKNLRICVDCHTVTKYISKIVKREIIVRDANRFHHFVNGECSCNDYW 814 >XP_015950445.1 PREDICTED: pentatricopeptide repeat-containing protein At3g12770-like [Arachis duranensis] XP_015950446.1 PREDICTED: pentatricopeptide repeat-containing protein At3g12770-like [Arachis duranensis] XP_015950447.1 PREDICTED: pentatricopeptide repeat-containing protein At3g12770-like [Arachis duranensis] XP_015950449.1 PREDICTED: pentatricopeptide repeat-containing protein At3g12770-like [Arachis duranensis] XP_015950450.1 PREDICTED: pentatricopeptide repeat-containing protein At3g12770-like [Arachis duranensis] Length = 840 Score = 103 bits (258), Expect = 2e-24 Identities = 46/48 (95%), Positives = 46/48 (95%) Frame = +3 Query: 3 ITKNLRVCVDCHTVTKYISRIVKREIIVRDANRFHHFVNGVCSCNDYW 146 ITKNLRVCVDCH VTKYISRIVKREIIVRDANRFHHFVNG CSCNDYW Sbjct: 793 ITKNLRVCVDCHNVTKYISRIVKREIIVRDANRFHHFVNGQCSCNDYW 840 >XP_007157720.1 hypothetical protein PHAVU_002G092700g [Phaseolus vulgaris] ESW29714.1 hypothetical protein PHAVU_002G092700g [Phaseolus vulgaris] Length = 820 Score = 103 bits (256), Expect = 4e-24 Identities = 45/48 (93%), Positives = 47/48 (97%) Frame = +3 Query: 3 ITKNLRVCVDCHTVTKYISRIVKREIIVRDANRFHHFVNGVCSCNDYW 146 ITKNLRVCVDCHTVTKYIS+IV+REIIVRDANRFHHFVNG CSCNDYW Sbjct: 773 ITKNLRVCVDCHTVTKYISKIVQREIIVRDANRFHHFVNGKCSCNDYW 820 >BAT75171.1 hypothetical protein VIGAN_01299100 [Vigna angularis var. angularis] Length = 705 Score = 102 bits (255), Expect = 6e-24 Identities = 44/48 (91%), Positives = 47/48 (97%) Frame = +3 Query: 3 ITKNLRVCVDCHTVTKYISRIVKREIIVRDANRFHHFVNGVCSCNDYW 146 ITKNLRVCVDCHT+TKYIS+IV+REIIVRDANRFHHFVNG CSCNDYW Sbjct: 658 ITKNLRVCVDCHTITKYISKIVQREIIVRDANRFHHFVNGKCSCNDYW 705 >KYP42578.1 Pentatricopeptide repeat-containing protein At1g11290 family [Cajanus cajan] Length = 770 Score = 102 bits (255), Expect = 6e-24 Identities = 44/48 (91%), Positives = 47/48 (97%) Frame = +3 Query: 3 ITKNLRVCVDCHTVTKYISRIVKREIIVRDANRFHHFVNGVCSCNDYW 146 ITKNLRVCVDCHTVTKYIS+IV+REIIVRDANRFHHF+NG CSCNDYW Sbjct: 723 ITKNLRVCVDCHTVTKYISKIVQREIIVRDANRFHHFINGECSCNDYW 770 >KOM32000.1 hypothetical protein LR48_Vigan01g155600 [Vigna angularis] Length = 797 Score = 102 bits (255), Expect = 6e-24 Identities = 44/48 (91%), Positives = 47/48 (97%) Frame = +3 Query: 3 ITKNLRVCVDCHTVTKYISRIVKREIIVRDANRFHHFVNGVCSCNDYW 146 ITKNLRVCVDCHT+TKYIS+IV+REIIVRDANRFHHFVNG CSCNDYW Sbjct: 750 ITKNLRVCVDCHTITKYISKIVQREIIVRDANRFHHFVNGKCSCNDYW 797 >XP_017425988.1 PREDICTED: pentatricopeptide repeat-containing protein At3g12770-like [Vigna angularis] Length = 820 Score = 102 bits (255), Expect = 6e-24 Identities = 44/48 (91%), Positives = 47/48 (97%) Frame = +3 Query: 3 ITKNLRVCVDCHTVTKYISRIVKREIIVRDANRFHHFVNGVCSCNDYW 146 ITKNLRVCVDCHT+TKYIS+IV+REIIVRDANRFHHFVNG CSCNDYW Sbjct: 773 ITKNLRVCVDCHTITKYISKIVQREIIVRDANRFHHFVNGKCSCNDYW 820 >XP_014506168.1 PREDICTED: pentatricopeptide repeat-containing protein At3g12770-like [Vigna radiata var. radiata] Length = 848 Score = 102 bits (254), Expect = 8e-24 Identities = 43/48 (89%), Positives = 47/48 (97%) Frame = +3 Query: 3 ITKNLRVCVDCHTVTKYISRIVKREIIVRDANRFHHFVNGVCSCNDYW 146 ITKNLR+CVDCHT+TKYIS+IV+REIIVRDANRFHHFVNG CSCNDYW Sbjct: 801 ITKNLRICVDCHTITKYISKIVQREIIVRDANRFHHFVNGKCSCNDYW 848 >XP_016183990.1 PREDICTED: pentatricopeptide repeat-containing protein At3g12770-like [Arachis ipaensis] XP_016183991.1 PREDICTED: pentatricopeptide repeat-containing protein At3g12770-like [Arachis ipaensis] XP_016183992.1 PREDICTED: pentatricopeptide repeat-containing protein At3g12770-like [Arachis ipaensis] Length = 840 Score = 102 bits (253), Expect = 1e-23 Identities = 45/48 (93%), Positives = 46/48 (95%) Frame = +3 Query: 3 ITKNLRVCVDCHTVTKYISRIVKREIIVRDANRFHHFVNGVCSCNDYW 146 ITKNLRVCVDCH VTKYISRIVKREIIVRDANRFHHFV+G CSCNDYW Sbjct: 793 ITKNLRVCVDCHNVTKYISRIVKREIIVRDANRFHHFVDGQCSCNDYW 840 >XP_004505258.1 PREDICTED: pentatricopeptide repeat-containing protein At3g12770-like [Cicer arietinum] Length = 815 Score = 101 bits (252), Expect = 1e-23 Identities = 44/48 (91%), Positives = 46/48 (95%) Frame = +3 Query: 3 ITKNLRVCVDCHTVTKYISRIVKREIIVRDANRFHHFVNGVCSCNDYW 146 ITKNLRVCVDCHTVTKYIS+IVKREIIVRDANRFHHF+NG CSCN YW Sbjct: 768 ITKNLRVCVDCHTVTKYISKIVKREIIVRDANRFHHFINGECSCNGYW 815 >EOY11186.1 Pentatricopeptide repeat superfamily protein [Theobroma cacao] Length = 815 Score = 100 bits (249), Expect = 4e-23 Identities = 42/48 (87%), Positives = 46/48 (95%) Frame = +3 Query: 3 ITKNLRVCVDCHTVTKYISRIVKREIIVRDANRFHHFVNGVCSCNDYW 146 ITKNLRVC+DCHT TKYIS++VKREIIVRDANRFHHFV+G CSCNDYW Sbjct: 768 ITKNLRVCIDCHTATKYISKVVKREIIVRDANRFHHFVDGKCSCNDYW 815 >AFG61376.1 hypothetical protein 0_7614_01, partial [Pinus taeda] Length = 110 Score = 92.8 bits (229), Expect = 5e-23 Identities = 38/48 (79%), Positives = 43/48 (89%) Frame = +3 Query: 3 ITKNLRVCVDCHTVTKYISRIVKREIIVRDANRFHHFVNGVCSCNDYW 146 + KNLRVC+DCHT TK+IS+IV REIIVRDANRFHHF NG+CSC DYW Sbjct: 63 VVKNLRVCIDCHTATKFISKIVGREIIVRDANRFHHFKNGLCSCGDYW 110 >AEW07637.1 hypothetical protein 0_7614_01, partial [Pinus radiata] AFG61375.1 hypothetical protein 0_7614_01, partial [Pinus taeda] AFG61377.1 hypothetical protein 0_7614_01, partial [Pinus taeda] AFG61378.1 hypothetical protein 0_7614_01, partial [Pinus taeda] AFG61379.1 hypothetical protein 0_7614_01, partial [Pinus taeda] AFG61380.1 hypothetical protein 0_7614_01, partial [Pinus taeda] AFG61381.1 hypothetical protein 0_7614_01, partial [Pinus taeda] AFG61382.1 hypothetical protein 0_7614_01, partial [Pinus taeda] AFG61383.1 hypothetical protein 0_7614_01, partial [Pinus taeda] AFG61384.1 hypothetical protein 0_7614_01, partial [Pinus taeda] AFG61385.1 hypothetical protein 0_7614_01, partial [Pinus taeda] AFG61386.1 hypothetical protein 0_7614_01, partial [Pinus taeda] AFG61387.1 hypothetical protein 0_7614_01, partial [Pinus taeda] AFG61388.1 hypothetical protein 0_7614_01, partial [Pinus taeda] AFG61389.1 hypothetical protein 0_7614_01, partial [Pinus taeda] AFG61390.1 hypothetical protein 0_7614_01, partial [Pinus taeda] Length = 110 Score = 92.8 bits (229), Expect = 5e-23 Identities = 38/48 (79%), Positives = 43/48 (89%) Frame = +3 Query: 3 ITKNLRVCVDCHTVTKYISRIVKREIIVRDANRFHHFVNGVCSCNDYW 146 + KNLRVC+DCHT TK+IS+IV REIIVRDANRFHHF NG+CSC DYW Sbjct: 63 VVKNLRVCIDCHTATKFISKIVGREIIVRDANRFHHFKNGLCSCGDYW 110 >KHN32251.1 Pentatricopeptide repeat-containing protein [Glycine soja] Length = 706 Score = 99.8 bits (247), Expect = 7e-23 Identities = 43/48 (89%), Positives = 46/48 (95%) Frame = +3 Query: 3 ITKNLRVCVDCHTVTKYISRIVKREIIVRDANRFHHFVNGVCSCNDYW 146 ITKNLRVCVDCH VTKYIS+IV+REIIVRDANRFHHFVNG CSCND+W Sbjct: 659 ITKNLRVCVDCHNVTKYISKIVQREIIVRDANRFHHFVNGKCSCNDFW 706 >XP_003556647.1 PREDICTED: pentatricopeptide repeat-containing protein At3g12770-like [Glycine max] KRG89280.1 hypothetical protein GLYMA_20G013300 [Glycine max] Length = 821 Score = 99.8 bits (247), Expect = 7e-23 Identities = 43/48 (89%), Positives = 46/48 (95%) Frame = +3 Query: 3 ITKNLRVCVDCHTVTKYISRIVKREIIVRDANRFHHFVNGVCSCNDYW 146 ITKNLRVCVDCH VTKYIS+IV+REIIVRDANRFHHFVNG CSCND+W Sbjct: 774 ITKNLRVCVDCHNVTKYISKIVQREIIVRDANRFHHFVNGKCSCNDFW 821 >XP_009342022.1 PREDICTED: pentatricopeptide repeat-containing protein At1g11290, chloroplastic-like [Pyrus x bretschneideri] Length = 813 Score = 99.0 bits (245), Expect = 1e-22 Identities = 42/48 (87%), Positives = 46/48 (95%) Frame = +3 Query: 3 ITKNLRVCVDCHTVTKYISRIVKREIIVRDANRFHHFVNGVCSCNDYW 146 ITKNLRVCVDCH VTKYIS+IV+RE+IVRDANRFHHFV+G CSCNDYW Sbjct: 766 ITKNLRVCVDCHNVTKYISKIVRRELIVRDANRFHHFVDGKCSCNDYW 813 >XP_016726350.1 PREDICTED: pentatricopeptide repeat-containing protein At4g33990-like isoform X2 [Gossypium hirsutum] Length = 498 Score = 98.2 bits (243), Expect = 2e-22 Identities = 42/48 (87%), Positives = 46/48 (95%) Frame = +3 Query: 3 ITKNLRVCVDCHTVTKYISRIVKREIIVRDANRFHHFVNGVCSCNDYW 146 I+KNLRVC DCHTVTKYIS++VKREIIVRDANRFHHFV+G CSCNDYW Sbjct: 451 ISKNLRVCGDCHTVTKYISKVVKREIIVRDANRFHHFVDGKCSCNDYW 498