BLASTX nr result
ID: Glycyrrhiza36_contig00031489
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza36_contig00031489 (279 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_013450993.1 plant calmodulin-binding-like protein [Medicago t... 55 9e-07 >XP_013450993.1 plant calmodulin-binding-like protein [Medicago truncatula] KEH25033.1 plant calmodulin-binding-like protein [Medicago truncatula] Length = 643 Score = 55.1 bits (131), Expect = 9e-07 Identities = 27/37 (72%), Positives = 31/37 (83%) Frame = -3 Query: 115 KADTLPKSTPQKVKTPSKSTPNKVETLSKSTPKKMEN 5 K +T KSTP+KVKTPSKSTP K+ETLSK PKK+EN Sbjct: 212 KVETPLKSTPKKVKTPSKSTPAKMETLSKWIPKKVEN 248