BLASTX nr result
ID: Glycyrrhiza36_contig00031194
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza36_contig00031194 (400 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value GAU36374.1 hypothetical protein TSUD_151410 [Trifolium subterran... 41 5e-07 >GAU36374.1 hypothetical protein TSUD_151410 [Trifolium subterraneum] Length = 474 Score = 41.2 bits (95), Expect(2) = 5e-07 Identities = 20/35 (57%), Positives = 26/35 (74%) Frame = +1 Query: 100 VRMGEAFGLLFAIKWMREHQSDNVIFKLDSKLVVE 204 VR+GEA GLL A++W+ E V F+LDSKLVV+ Sbjct: 365 VRIGEALGLLSALRWVHELNFGPVDFELDSKLVVD 399 Score = 39.7 bits (91), Expect(2) = 5e-07 Identities = 21/41 (51%), Positives = 26/41 (63%) Frame = +2 Query: 278 FIFL*QLSYMEFSRRQANMVVHSLAKVAIFRASPRIFFLYP 400 F L S +EF RRQAN +VHSL+K A + ASP+I P Sbjct: 422 FSLLYNNSSVEFIRRQANKIVHSLSKAATYVASPQILVNIP 462