BLASTX nr result
ID: Glycyrrhiza36_contig00031010
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza36_contig00031010 (486 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_013461328.1 hypothetical protein MTR_3g088705 [Medicago trunc... 57 4e-08 >XP_013461328.1 hypothetical protein MTR_3g088705 [Medicago truncatula] KEH35363.1 hypothetical protein MTR_3g088705 [Medicago truncatula] Length = 67 Score = 57.0 bits (136), Expect = 4e-08 Identities = 29/55 (52%), Positives = 38/55 (69%), Gaps = 9/55 (16%) Frame = -1 Query: 486 HKPKNGSVFPAKRCSVKQMMWNRVVE---------LVTPPPKLSQCNKSNSVVHP 349 HKPKNGSVFPAK+ SVK+MMW++ V+ V+PPP Q +++NS VHP Sbjct: 14 HKPKNGSVFPAKKRSVKKMMWDQFVDPKGNNSSSNTVSPPP--PQSSRANSTVHP 66