BLASTX nr result
ID: Glycyrrhiza36_contig00030518
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza36_contig00030518 (300 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_013453551.1 F-box protein interaction domain protein [Medicag... 64 1e-09 XP_003612244.2 F-box protein interaction domain protein [Medicag... 63 2e-09 XP_004512128.1 PREDICTED: F-box protein At3g07870-like [Cicer ar... 62 3e-09 XP_003610871.2 F-box protein interaction domain protein [Medicag... 62 4e-09 XP_013449582.1 F-box protein interaction domain protein [Medicag... 62 4e-09 XP_003612169.2 F-box protein interaction domain protein [Medicag... 62 6e-09 XP_019454515.1 PREDICTED: F-box/kelch-repeat protein At3g06240-l... 60 1e-08 XP_013453553.1 F-box protein interaction domain protein [Medicag... 60 2e-08 AFK40065.1 unknown [Medicago truncatula] 58 9e-08 XP_003612151.2 F-box protein interaction domain protein [Medicag... 54 2e-06 XP_013455133.1 F-box protein interaction domain protein [Medicag... 54 2e-06 XP_003612229.2 F-box protein interaction domain protein [Medicag... 54 3e-06 GAU24035.1 hypothetical protein TSUD_328390 [Trifolium subterran... 53 5e-06 AFK37781.1 unknown [Lotus japonicus] 53 5e-06 GAU36234.1 hypothetical protein TSUD_214310 [Trifolium subterran... 53 7e-06 >XP_013453551.1 F-box protein interaction domain protein [Medicago truncatula] KEH27584.1 F-box protein interaction domain protein [Medicago truncatula] Length = 496 Score = 63.5 bits (153), Expect = 1e-09 Identities = 30/38 (78%), Positives = 33/38 (86%) Frame = -1 Query: 300 PSLISLKDAMKGDNIEVLNVHSRCANFKLAEEAKVLYL 187 PSLISLKD +KGDNIEVLN+HSRCA FKL EE +VL L Sbjct: 451 PSLISLKDVLKGDNIEVLNIHSRCAKFKLREEKEVLSL 488 >XP_003612244.2 F-box protein interaction domain protein [Medicago truncatula] AES95202.2 F-box protein interaction domain protein [Medicago truncatula] Length = 482 Score = 63.2 bits (152), Expect = 2e-09 Identities = 30/41 (73%), Positives = 34/41 (82%) Frame = -1 Query: 300 PSLISLKDAMKGDNIEVLNVHSRCANFKLAEEAKVLYLTRD 178 PSLISLKD +KGDNIEVLN+HSRCA FKL EE VL L ++ Sbjct: 440 PSLISLKDVLKGDNIEVLNIHSRCAKFKLREERDVLSLFQE 480 >XP_004512128.1 PREDICTED: F-box protein At3g07870-like [Cicer arietinum] XP_004512171.1 PREDICTED: F-box protein At3g07870-like [Cicer arietinum] XP_012574463.1 PREDICTED: F-box protein At3g07870-like [Cicer arietinum] XP_012574465.1 PREDICTED: F-box protein At3g07870-like [Cicer arietinum] Length = 488 Score = 62.4 bits (150), Expect = 3e-09 Identities = 29/41 (70%), Positives = 34/41 (82%) Frame = -1 Query: 300 PSLISLKDAMKGDNIEVLNVHSRCANFKLAEEAKVLYLTRD 178 PSLISLKD +KGDNIEVLN+HSRC FKL EE +VL L ++ Sbjct: 437 PSLISLKDVVKGDNIEVLNIHSRCTKFKLPEENEVLSLVQE 477 >XP_003610871.2 F-box protein interaction domain protein [Medicago truncatula] AES93829.2 F-box protein interaction domain protein [Medicago truncatula] Length = 448 Score = 62.0 bits (149), Expect = 4e-09 Identities = 29/40 (72%), Positives = 34/40 (85%) Frame = -1 Query: 300 PSLISLKDAMKGDNIEVLNVHSRCANFKLAEEAKVLYLTR 181 PSLISLKD +KGDNIEVLN+HSRCA FKL EE + L L++ Sbjct: 406 PSLISLKDVLKGDNIEVLNIHSRCAKFKLREETEGLSLSQ 445 >XP_013449582.1 F-box protein interaction domain protein [Medicago truncatula] KEH23610.1 F-box protein interaction domain protein [Medicago truncatula] Length = 305 Score = 61.6 bits (148), Expect = 4e-09 Identities = 27/41 (65%), Positives = 36/41 (87%) Frame = -1 Query: 300 PSLISLKDAMKGDNIEVLNVHSRCANFKLAEEAKVLYLTRD 178 PSLISLKD +KGDNIEV ++HSRCA +KL EE++VL+L ++ Sbjct: 263 PSLISLKDVVKGDNIEVFSIHSRCAKYKLWEESEVLFLAQE 303 >XP_003612169.2 F-box protein interaction domain protein [Medicago truncatula] AES95127.2 F-box protein interaction domain protein [Medicago truncatula] Length = 490 Score = 61.6 bits (148), Expect = 6e-09 Identities = 29/40 (72%), Positives = 35/40 (87%) Frame = -1 Query: 300 PSLISLKDAMKGDNIEVLNVHSRCANFKLAEEAKVLYLTR 181 PSLISLKD +KGDNIEVLN+HSRCAN +L EE +VL L++ Sbjct: 448 PSLISLKDVVKGDNIEVLNIHSRCANVELPEENEVLSLSQ 487 >XP_019454515.1 PREDICTED: F-box/kelch-repeat protein At3g06240-like isoform X1 [Lupinus angustifolius] Length = 468 Score = 60.5 bits (145), Expect = 1e-08 Identities = 28/38 (73%), Positives = 33/38 (86%) Frame = -1 Query: 300 PSLISLKDAMKGDNIEVLNVHSRCANFKLAEEAKVLYL 187 PSLISLKDA+KG+N+EVLNVH RCA FKL EE + L+L Sbjct: 430 PSLISLKDAVKGNNVEVLNVHLRCAKFKLREENEALFL 467 >XP_013453553.1 F-box protein interaction domain protein [Medicago truncatula] KEH27586.1 F-box protein interaction domain protein [Medicago truncatula] Length = 459 Score = 60.1 bits (144), Expect = 2e-08 Identities = 28/40 (70%), Positives = 34/40 (85%) Frame = -1 Query: 300 PSLISLKDAMKGDNIEVLNVHSRCANFKLAEEAKVLYLTR 181 PSLISLKD +KGDN E+LN+HSRCAN KL EE +VL L++ Sbjct: 417 PSLISLKDVVKGDNTEMLNIHSRCANVKLEEENEVLSLSQ 456 >AFK40065.1 unknown [Medicago truncatula] Length = 479 Score = 58.2 bits (139), Expect = 9e-08 Identities = 28/40 (70%), Positives = 33/40 (82%) Frame = -1 Query: 300 PSLISLKDAMKGDNIEVLNVHSRCANFKLAEEAKVLYLTR 181 PSLISLKD +KG NIEVLN+HSRCA FKL E +VL L++ Sbjct: 437 PSLISLKDVLKGVNIEVLNIHSRCAKFKLRGEKEVLSLSQ 476 >XP_003612151.2 F-box protein interaction domain protein [Medicago truncatula] AES95109.2 F-box protein interaction domain protein [Medicago truncatula] Length = 512 Score = 54.3 bits (129), Expect = 2e-06 Identities = 26/36 (72%), Positives = 29/36 (80%) Frame = -1 Query: 300 PSLISLKDAMKGDNIEVLNVHSRCANFKLAEEAKVL 193 PSLISLKD +KG NIEVLN+HSRCA FKL E + L Sbjct: 437 PSLISLKDVLKGVNIEVLNIHSRCAKFKLRGEKESL 472 >XP_013455133.1 F-box protein interaction domain protein [Medicago truncatula] KEH29181.1 F-box protein interaction domain protein [Medicago truncatula] Length = 520 Score = 54.3 bits (129), Expect = 2e-06 Identities = 26/36 (72%), Positives = 29/36 (80%) Frame = -1 Query: 300 PSLISLKDAMKGDNIEVLNVHSRCANFKLAEEAKVL 193 PSLISLKD +KG NIEVLN+HSRCA FKL E + L Sbjct: 437 PSLISLKDVLKGVNIEVLNIHSRCAKFKLRGEKESL 472 >XP_003612229.2 F-box protein interaction domain protein [Medicago truncatula] AES95187.2 F-box protein interaction domain protein [Medicago truncatula] Length = 423 Score = 53.9 bits (128), Expect = 3e-06 Identities = 27/41 (65%), Positives = 34/41 (82%), Gaps = 1/41 (2%) Frame = -1 Query: 300 PSLISLKDAMKGDNIEVLNVHS-RCANFKLAEEAKVLYLTR 181 PSLISLK+A+ GDN+EVLNV+S RCA FKL EE++V L + Sbjct: 358 PSLISLKEAVNGDNVEVLNVYSRRCAKFKLREESEVFSLVQ 398 >GAU24035.1 hypothetical protein TSUD_328390 [Trifolium subterraneum] Length = 341 Score = 53.1 bits (126), Expect = 5e-06 Identities = 26/41 (63%), Positives = 34/41 (82%), Gaps = 1/41 (2%) Frame = -1 Query: 300 PSLISLKDAMKG-DNIEVLNVHSRCANFKLAEEAKVLYLTR 181 PSLISLKD +KG DN EVL++HSRCA +KL E+ +VL+L + Sbjct: 288 PSLISLKDIVKGGDNNEVLSIHSRCAKYKLPEDNEVLFLAQ 328 >AFK37781.1 unknown [Lotus japonicus] Length = 489 Score = 53.1 bits (126), Expect = 5e-06 Identities = 26/40 (65%), Positives = 29/40 (72%) Frame = -1 Query: 300 PSLISLKDAMKGDNIEVLNVHSRCANFKLAEEAKVLYLTR 181 PS ISLKD +KGDNIEVLNVHSR FK EE L+L + Sbjct: 433 PSFISLKDVVKGDNIEVLNVHSRYEEFKFMEENADLFLAK 472 >GAU36234.1 hypothetical protein TSUD_214310 [Trifolium subterraneum] Length = 357 Score = 52.8 bits (125), Expect = 7e-06 Identities = 24/32 (75%), Positives = 29/32 (90%) Frame = -1 Query: 300 PSLISLKDAMKGDNIEVLNVHSRCANFKLAEE 205 PSLISLKDA++ DN++VLNV+SRCA FKL EE Sbjct: 326 PSLISLKDAVRRDNVDVLNVNSRCAKFKLPEE 357