BLASTX nr result
ID: Glycyrrhiza36_contig00029132
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza36_contig00029132 (250 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_004509866.1 PREDICTED: uncharacterized protein LOC101502704 [... 53 2e-06 XP_003628662.1 DUF4228 domain protein [Medicago truncatula] AET0... 52 2e-06 >XP_004509866.1 PREDICTED: uncharacterized protein LOC101502704 [Cicer arietinum] Length = 172 Score = 52.8 bits (125), Expect = 2e-06 Identities = 26/37 (70%), Positives = 30/37 (81%) Frame = -1 Query: 232 ELML*LQNEFQAMRADRQRLRVASVSTAAPRPKSWRP 122 E ML +QAMRADR+RLRV+SV+ AAPRPKSWRP Sbjct: 126 EGMLDTGKMYQAMRADRRRLRVSSVNPAAPRPKSWRP 162 >XP_003628662.1 DUF4228 domain protein [Medicago truncatula] AET03138.1 DUF4228 domain protein [Medicago truncatula] Length = 173 Score = 52.4 bits (124), Expect = 2e-06 Identities = 26/37 (70%), Positives = 28/37 (75%) Frame = -1 Query: 232 ELML*LQNEFQAMRADRQRLRVASVSTAAPRPKSWRP 122 E ML +QAMRADRQRLRV SV+ A PRPKSWRP Sbjct: 127 EGMLDTGRMYQAMRADRQRLRVVSVNPAVPRPKSWRP 163