BLASTX nr result
ID: Glycyrrhiza36_contig00029019
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza36_contig00029019 (261 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_004510588.1 PREDICTED: uncharacterized protein LOC101496484 [... 58 7e-15 XP_015968284.1 PREDICTED: uncharacterized protein LOC107491882 [... 58 7e-15 XP_019461944.1 PREDICTED: uncharacterized protein LOC109361081 [... 58 7e-15 XP_003529861.1 PREDICTED: uncharacterized protein LOC100776069 [... 58 7e-15 XP_014518990.1 PREDICTED: uncharacterized protein LOC106776152 [... 58 7e-15 XP_014521626.1 PREDICTED: uncharacterized protein LOC106778202 [... 58 7e-15 XP_016206308.1 PREDICTED: uncharacterized protein LOC107646648 [... 58 7e-15 KHN01480.1 hypothetical protein glysoja_009686 [Glycine soja] 58 7e-15 KYP43643.1 hypothetical protein KK1_034924 [Cajanus cajan] 58 1e-14 XP_017441388.1 PREDICTED: uncharacterized protein LOC108346849 [... 58 1e-14 KOM56986.1 hypothetical protein LR48_Vigan11g001800 [Vigna angul... 58 1e-14 XP_003627474.1 GDP-fucose protein O-fucosyltransferase [Medicago... 58 2e-14 XP_013444497.1 GDP-fucose protein O-fucosyltransferase [Medicago... 58 2e-14 ACJ85563.1 unknown [Medicago truncatula] 58 2e-14 XP_019430297.1 PREDICTED: uncharacterized protein LOC109337715 [... 56 4e-14 XP_019440481.1 PREDICTED: uncharacterized protein LOC109345750 [... 60 4e-14 XP_012068783.1 PREDICTED: uncharacterized protein LOC105631313 [... 59 6e-14 OAY36313.1 hypothetical protein MANES_11G011700 [Manihot esculenta] 59 6e-14 XP_007135356.1 hypothetical protein PHAVU_010G122400g [Phaseolus... 57 1e-13 XP_006357428.1 PREDICTED: uncharacterized protein LOC102602087 [... 57 1e-13 >XP_004510588.1 PREDICTED: uncharacterized protein LOC101496484 [Cicer arietinum] Length = 549 Score = 58.2 bits (139), Expect(2) = 7e-15 Identities = 26/32 (81%), Positives = 28/32 (87%) Frame = +3 Query: 3 AQRFIQTFLGRNFVALHFRRHGFLKFWCVLRP 98 AQRFIQTFLGRNF+ALHFRRHGFLKF +P Sbjct: 382 AQRFIQTFLGRNFIALHFRRHGFLKFCNAKKP 413 Score = 49.3 bits (116), Expect(2) = 7e-15 Identities = 21/21 (100%), Positives = 21/21 (100%) Frame = +2 Query: 197 NAKKPSCFYPIPQAADCILRV 259 NAKKPSCFYPIPQAADCILRV Sbjct: 409 NAKKPSCFYPIPQAADCILRV 429 >XP_015968284.1 PREDICTED: uncharacterized protein LOC107491882 [Arachis duranensis] Length = 546 Score = 58.2 bits (139), Expect(2) = 7e-15 Identities = 26/32 (81%), Positives = 28/32 (87%) Frame = +3 Query: 3 AQRFIQTFLGRNFVALHFRRHGFLKFWCVLRP 98 AQRFIQTFLGRNF+ALHFRRHGFLKF +P Sbjct: 379 AQRFIQTFLGRNFIALHFRRHGFLKFCNAKKP 410 Score = 49.3 bits (116), Expect(2) = 7e-15 Identities = 21/21 (100%), Positives = 21/21 (100%) Frame = +2 Query: 197 NAKKPSCFYPIPQAADCILRV 259 NAKKPSCFYPIPQAADCILRV Sbjct: 406 NAKKPSCFYPIPQAADCILRV 426 >XP_019461944.1 PREDICTED: uncharacterized protein LOC109361081 [Lupinus angustifolius] OIW02500.1 hypothetical protein TanjilG_05093 [Lupinus angustifolius] Length = 544 Score = 58.2 bits (139), Expect(2) = 7e-15 Identities = 26/32 (81%), Positives = 28/32 (87%) Frame = +3 Query: 3 AQRFIQTFLGRNFVALHFRRHGFLKFWCVLRP 98 AQRFIQTFLGRNF+ALHFRRHGFLKF +P Sbjct: 377 AQRFIQTFLGRNFIALHFRRHGFLKFCNAKKP 408 Score = 49.3 bits (116), Expect(2) = 7e-15 Identities = 21/21 (100%), Positives = 21/21 (100%) Frame = +2 Query: 197 NAKKPSCFYPIPQAADCILRV 259 NAKKPSCFYPIPQAADCILRV Sbjct: 404 NAKKPSCFYPIPQAADCILRV 424 >XP_003529861.1 PREDICTED: uncharacterized protein LOC100776069 [Glycine max] KRH47726.1 hypothetical protein GLYMA_07G046500 [Glycine max] Length = 543 Score = 58.2 bits (139), Expect(2) = 7e-15 Identities = 26/32 (81%), Positives = 28/32 (87%) Frame = +3 Query: 3 AQRFIQTFLGRNFVALHFRRHGFLKFWCVLRP 98 AQRFIQTFLGRNF+ALHFRRHGFLKF +P Sbjct: 376 AQRFIQTFLGRNFIALHFRRHGFLKFCNAKKP 407 Score = 49.3 bits (116), Expect(2) = 7e-15 Identities = 21/21 (100%), Positives = 21/21 (100%) Frame = +2 Query: 197 NAKKPSCFYPIPQAADCILRV 259 NAKKPSCFYPIPQAADCILRV Sbjct: 403 NAKKPSCFYPIPQAADCILRV 423 >XP_014518990.1 PREDICTED: uncharacterized protein LOC106776152 [Vigna radiata var. radiata] Length = 542 Score = 58.2 bits (139), Expect(2) = 7e-15 Identities = 26/32 (81%), Positives = 28/32 (87%) Frame = +3 Query: 3 AQRFIQTFLGRNFVALHFRRHGFLKFWCVLRP 98 AQRFIQTFLGRNF+ALHFRRHGFLKF +P Sbjct: 375 AQRFIQTFLGRNFIALHFRRHGFLKFCNAKKP 406 Score = 49.3 bits (116), Expect(2) = 7e-15 Identities = 21/21 (100%), Positives = 21/21 (100%) Frame = +2 Query: 197 NAKKPSCFYPIPQAADCILRV 259 NAKKPSCFYPIPQAADCILRV Sbjct: 402 NAKKPSCFYPIPQAADCILRV 422 >XP_014521626.1 PREDICTED: uncharacterized protein LOC106778202 [Vigna radiata var. radiata] Length = 541 Score = 58.2 bits (139), Expect(2) = 7e-15 Identities = 26/32 (81%), Positives = 28/32 (87%) Frame = +3 Query: 3 AQRFIQTFLGRNFVALHFRRHGFLKFWCVLRP 98 AQRFIQTFLGRNF+ALHFRRHGFLKF +P Sbjct: 374 AQRFIQTFLGRNFIALHFRRHGFLKFCNAKKP 405 Score = 49.3 bits (116), Expect(2) = 7e-15 Identities = 21/21 (100%), Positives = 21/21 (100%) Frame = +2 Query: 197 NAKKPSCFYPIPQAADCILRV 259 NAKKPSCFYPIPQAADCILRV Sbjct: 401 NAKKPSCFYPIPQAADCILRV 421 >XP_016206308.1 PREDICTED: uncharacterized protein LOC107646648 [Arachis ipaensis] Length = 495 Score = 58.2 bits (139), Expect(2) = 7e-15 Identities = 26/32 (81%), Positives = 28/32 (87%) Frame = +3 Query: 3 AQRFIQTFLGRNFVALHFRRHGFLKFWCVLRP 98 AQRFIQTFLGRNF+ALHFRRHGFLKF +P Sbjct: 328 AQRFIQTFLGRNFIALHFRRHGFLKFCNAKKP 359 Score = 49.3 bits (116), Expect(2) = 7e-15 Identities = 21/21 (100%), Positives = 21/21 (100%) Frame = +2 Query: 197 NAKKPSCFYPIPQAADCILRV 259 NAKKPSCFYPIPQAADCILRV Sbjct: 355 NAKKPSCFYPIPQAADCILRV 375 >KHN01480.1 hypothetical protein glysoja_009686 [Glycine soja] Length = 455 Score = 58.2 bits (139), Expect(2) = 7e-15 Identities = 26/32 (81%), Positives = 28/32 (87%) Frame = +3 Query: 3 AQRFIQTFLGRNFVALHFRRHGFLKFWCVLRP 98 AQRFIQTFLGRNF+ALHFRRHGFLKF +P Sbjct: 288 AQRFIQTFLGRNFIALHFRRHGFLKFCNAKKP 319 Score = 49.3 bits (116), Expect(2) = 7e-15 Identities = 21/21 (100%), Positives = 21/21 (100%) Frame = +2 Query: 197 NAKKPSCFYPIPQAADCILRV 259 NAKKPSCFYPIPQAADCILRV Sbjct: 315 NAKKPSCFYPIPQAADCILRV 335 >KYP43643.1 hypothetical protein KK1_034924 [Cajanus cajan] Length = 539 Score = 57.8 bits (138), Expect(2) = 1e-14 Identities = 25/32 (78%), Positives = 28/32 (87%) Frame = +3 Query: 3 AQRFIQTFLGRNFVALHFRRHGFLKFWCVLRP 98 AQRF+QTFLGRNF+ALHFRRHGFLKF +P Sbjct: 372 AQRFVQTFLGRNFIALHFRRHGFLKFCNAKKP 403 Score = 49.3 bits (116), Expect(2) = 1e-14 Identities = 21/21 (100%), Positives = 21/21 (100%) Frame = +2 Query: 197 NAKKPSCFYPIPQAADCILRV 259 NAKKPSCFYPIPQAADCILRV Sbjct: 399 NAKKPSCFYPIPQAADCILRV 419 >XP_017441388.1 PREDICTED: uncharacterized protein LOC108346849 [Vigna angularis] BAT98220.1 hypothetical protein VIGAN_09186000 [Vigna angularis var. angularis] Length = 543 Score = 58.2 bits (139), Expect(2) = 1e-14 Identities = 26/32 (81%), Positives = 28/32 (87%) Frame = +3 Query: 3 AQRFIQTFLGRNFVALHFRRHGFLKFWCVLRP 98 AQRFIQTFLGRNF+ALHFRRHGFLKF +P Sbjct: 376 AQRFIQTFLGRNFIALHFRRHGFLKFCNAKKP 407 Score = 48.5 bits (114), Expect(2) = 1e-14 Identities = 20/21 (95%), Positives = 21/21 (100%) Frame = +2 Query: 197 NAKKPSCFYPIPQAADCILRV 259 NAKKPSCFYPIPQAADCI+RV Sbjct: 403 NAKKPSCFYPIPQAADCIMRV 423 >KOM56986.1 hypothetical protein LR48_Vigan11g001800 [Vigna angularis] Length = 454 Score = 58.2 bits (139), Expect(2) = 1e-14 Identities = 26/32 (81%), Positives = 28/32 (87%) Frame = +3 Query: 3 AQRFIQTFLGRNFVALHFRRHGFLKFWCVLRP 98 AQRFIQTFLGRNF+ALHFRRHGFLKF +P Sbjct: 287 AQRFIQTFLGRNFIALHFRRHGFLKFCNAKKP 318 Score = 48.5 bits (114), Expect(2) = 1e-14 Identities = 20/21 (95%), Positives = 21/21 (100%) Frame = +2 Query: 197 NAKKPSCFYPIPQAADCILRV 259 NAKKPSCFYPIPQAADCI+RV Sbjct: 314 NAKKPSCFYPIPQAADCIMRV 334 >XP_003627474.1 GDP-fucose protein O-fucosyltransferase [Medicago truncatula] AET01950.1 GDP-fucose protein O-fucosyltransferase [Medicago truncatula] Length = 542 Score = 58.2 bits (139), Expect(2) = 2e-14 Identities = 26/32 (81%), Positives = 28/32 (87%) Frame = +3 Query: 3 AQRFIQTFLGRNFVALHFRRHGFLKFWCVLRP 98 AQRFIQTFLGRNF+ALHFRRHGFLKF +P Sbjct: 375 AQRFIQTFLGRNFIALHFRRHGFLKFCNAKKP 406 Score = 47.8 bits (112), Expect(2) = 2e-14 Identities = 20/21 (95%), Positives = 21/21 (100%) Frame = +2 Query: 197 NAKKPSCFYPIPQAADCILRV 259 NAKKPSCF+PIPQAADCILRV Sbjct: 402 NAKKPSCFFPIPQAADCILRV 422 >XP_013444497.1 GDP-fucose protein O-fucosyltransferase [Medicago truncatula] KEH18522.1 GDP-fucose protein O-fucosyltransferase [Medicago truncatula] Length = 489 Score = 58.2 bits (139), Expect(2) = 2e-14 Identities = 26/32 (81%), Positives = 28/32 (87%) Frame = +3 Query: 3 AQRFIQTFLGRNFVALHFRRHGFLKFWCVLRP 98 AQRFIQTFLGRNF+ALHFRRHGFLKF +P Sbjct: 375 AQRFIQTFLGRNFIALHFRRHGFLKFCNAKKP 406 Score = 47.8 bits (112), Expect(2) = 2e-14 Identities = 20/21 (95%), Positives = 21/21 (100%) Frame = +2 Query: 197 NAKKPSCFYPIPQAADCILRV 259 NAKKPSCF+PIPQAADCILRV Sbjct: 402 NAKKPSCFFPIPQAADCILRV 422 >ACJ85563.1 unknown [Medicago truncatula] Length = 242 Score = 58.2 bits (139), Expect(2) = 2e-14 Identities = 26/32 (81%), Positives = 28/32 (87%) Frame = +3 Query: 3 AQRFIQTFLGRNFVALHFRRHGFLKFWCVLRP 98 AQRFIQTFLGRNF+ALHFRRHGFLKF +P Sbjct: 75 AQRFIQTFLGRNFIALHFRRHGFLKFCNAKKP 106 Score = 47.8 bits (112), Expect(2) = 2e-14 Identities = 20/21 (95%), Positives = 21/21 (100%) Frame = +2 Query: 197 NAKKPSCFYPIPQAADCILRV 259 NAKKPSCF+PIPQAADCILRV Sbjct: 102 NAKKPSCFFPIPQAADCILRV 122 >XP_019430297.1 PREDICTED: uncharacterized protein LOC109337715 [Lupinus angustifolius] OIW16656.1 hypothetical protein TanjilG_23158 [Lupinus angustifolius] Length = 550 Score = 55.8 bits (133), Expect(2) = 4e-14 Identities = 25/32 (78%), Positives = 27/32 (84%) Frame = +3 Query: 3 AQRFIQTFLGRNFVALHFRRHGFLKFWCVLRP 98 AQRFIQTFLGR F+ALHFRRHGFLKF +P Sbjct: 383 AQRFIQTFLGRKFIALHFRRHGFLKFCNAKKP 414 Score = 49.3 bits (116), Expect(2) = 4e-14 Identities = 21/21 (100%), Positives = 21/21 (100%) Frame = +2 Query: 197 NAKKPSCFYPIPQAADCILRV 259 NAKKPSCFYPIPQAADCILRV Sbjct: 410 NAKKPSCFYPIPQAADCILRV 430 >XP_019440481.1 PREDICTED: uncharacterized protein LOC109345750 [Lupinus angustifolius] OIW13520.1 hypothetical protein TanjilG_29261 [Lupinus angustifolius] Length = 541 Score = 59.7 bits (143), Expect(2) = 4e-14 Identities = 27/32 (84%), Positives = 29/32 (90%) Frame = +3 Query: 3 AQRFIQTFLGRNFVALHFRRHGFLKFWCVLRP 98 AQRFIQTFLGRNF+ALHFRRHGFLKF V +P Sbjct: 374 AQRFIQTFLGRNFIALHFRRHGFLKFCNVKKP 405 Score = 45.4 bits (106), Expect(2) = 4e-14 Identities = 19/21 (90%), Positives = 19/21 (90%) Frame = +2 Query: 197 NAKKPSCFYPIPQAADCILRV 259 N KKPSCFYPIPQAADCI RV Sbjct: 401 NVKKPSCFYPIPQAADCISRV 421 >XP_012068783.1 PREDICTED: uncharacterized protein LOC105631313 [Jatropha curcas] KDP40618.1 hypothetical protein JCGZ_24617 [Jatropha curcas] Length = 607 Score = 58.5 bits (140), Expect(2) = 6e-14 Identities = 26/32 (81%), Positives = 29/32 (90%) Frame = +3 Query: 3 AQRFIQTFLGRNFVALHFRRHGFLKFWCVLRP 98 AQRFIQTFLG+NF+ALHFRRHGFLKF V +P Sbjct: 440 AQRFIQTFLGKNFIALHFRRHGFLKFCNVKKP 471 Score = 45.8 bits (107), Expect(2) = 6e-14 Identities = 19/21 (90%), Positives = 19/21 (90%) Frame = +2 Query: 197 NAKKPSCFYPIPQAADCILRV 259 N KKPSCFYPIPQAADCI RV Sbjct: 467 NVKKPSCFYPIPQAADCIARV 487 >OAY36313.1 hypothetical protein MANES_11G011700 [Manihot esculenta] Length = 562 Score = 58.5 bits (140), Expect(2) = 6e-14 Identities = 26/32 (81%), Positives = 29/32 (90%) Frame = +3 Query: 3 AQRFIQTFLGRNFVALHFRRHGFLKFWCVLRP 98 AQRFIQTFLG+NF+ALHFRRHGFLKF V +P Sbjct: 395 AQRFIQTFLGKNFIALHFRRHGFLKFCNVKKP 426 Score = 45.8 bits (107), Expect(2) = 6e-14 Identities = 19/21 (90%), Positives = 19/21 (90%) Frame = +2 Query: 197 NAKKPSCFYPIPQAADCILRV 259 N KKPSCFYPIPQAADCI RV Sbjct: 422 NVKKPSCFYPIPQAADCIARV 442 >XP_007135356.1 hypothetical protein PHAVU_010G122400g [Phaseolus vulgaris] ESW07350.1 hypothetical protein PHAVU_010G122400g [Phaseolus vulgaris] Length = 544 Score = 57.4 bits (137), Expect(2) = 1e-13 Identities = 26/32 (81%), Positives = 28/32 (87%) Frame = +3 Query: 3 AQRFIQTFLGRNFVALHFRRHGFLKFWCVLRP 98 AQRFIQTFLG+NFVALHFRRHGFLKF +P Sbjct: 377 AQRFIQTFLGKNFVALHFRRHGFLKFCNAKKP 408 Score = 46.2 bits (108), Expect(2) = 1e-13 Identities = 19/21 (90%), Positives = 21/21 (100%) Frame = +2 Query: 197 NAKKPSCFYPIPQAADCILRV 259 NAKKPSCF+PIPQAA+CILRV Sbjct: 404 NAKKPSCFFPIPQAAECILRV 424 >XP_006357428.1 PREDICTED: uncharacterized protein LOC102602087 [Solanum tuberosum] Length = 565 Score = 57.0 bits (136), Expect(2) = 1e-13 Identities = 25/32 (78%), Positives = 28/32 (87%) Frame = +3 Query: 3 AQRFIQTFLGRNFVALHFRRHGFLKFWCVLRP 98 AQRFIQTFLG+NF+ALHFRRHGFLKF +P Sbjct: 398 AQRFIQTFLGKNFIALHFRRHGFLKFCNAKKP 429 Score = 46.2 bits (108), Expect(2) = 1e-13 Identities = 19/21 (90%), Positives = 20/21 (95%) Frame = +2 Query: 197 NAKKPSCFYPIPQAADCILRV 259 NAKKPSCFYP+PQAADCI RV Sbjct: 425 NAKKPSCFYPVPQAADCINRV 445