BLASTX nr result
ID: Glycyrrhiza36_contig00028956
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza36_contig00028956 (491 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value KGN66469.1 hypothetical protein Csa_1G612925 [Cucumis sativus] 265 7e-89 XP_009393405.2 PREDICTED: histone H3.2 [Musa acuminata subsp. ma... 265 8e-89 NP_001238509.1 uncharacterized protein LOC100306416 [Glycine max... 263 1e-88 KYP58465.1 Histone H3.2, partial [Cajanus cajan] 263 1e-88 JAU76986.1 Histone H3.2, partial [Noccaea caerulescens] 264 2e-88 XP_008669425.1 PREDICTED: histone H3.2-like [Zea mays] 264 2e-88 XP_020195127.1 histone H3.2-like [Aegilops tauschii subsp. tausc... 263 3e-88 XP_020168912.1 histone H3.2-like [Aegilops tauschii subsp. tausc... 262 4e-88 XP_019199849.1 PREDICTED: histone H3.2-like [Ipomoea nil] 262 4e-88 NP_189372.1 Histone superfamily protein [Arabidopsis thaliana] N... 262 4e-88 CBH32561.1 histone H3, expressed [Triticum aestivum] BAJ89751.1 ... 262 4e-88 JAU22951.1 Histone H3.2, partial [Noccaea caerulescens] 263 4e-88 XP_006301260.1 hypothetical protein CARUB_v10021660mg, partial [... 263 4e-88 JAU86177.1 Histone H3.2, partial [Noccaea caerulescens] 263 4e-88 JAU40640.1 Histone H3.2, partial [Noccaea caerulescens] 263 4e-88 XP_017621393.1 PREDICTED: histone H3.2-like [Gossypium arboreum] 262 5e-88 AAA32655.1 histone H3 (H3-1.1) [Medicago sativa] 262 5e-88 XP_010260926.1 PREDICTED: histone H3.2-like [Nelumbo nucifera] 262 5e-88 CDP18134.1 unnamed protein product [Coffea canephora] 262 5e-88 EOY31042.1 Histone superfamily protein [Theobroma cacao] 265 5e-88 >KGN66469.1 hypothetical protein Csa_1G612925 [Cucumis sativus] Length = 171 Score = 265 bits (678), Expect = 7e-89 Identities = 141/152 (92%), Positives = 144/152 (94%) Frame = +1 Query: 34 SN*RYPCFRSVRV*ERMARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRP 213 SN R P F S + +MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRP Sbjct: 21 SNPRSPKFPSESL-SQMARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRP 79 Query: 214 GTVALREIRKYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVSALQEAAEAYLVGL 393 GTVALREIRKYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAV+ALQEAAEAYLVGL Sbjct: 80 GTVALREIRKYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVAALQEAAEAYLVGL 139 Query: 394 FEDTNLCAIHAKRVTIMPKDIQLARRIRGERA 489 FEDTNLCAIHAKRVTIMPKDIQLARRIRGERA Sbjct: 140 FEDTNLCAIHAKRVTIMPKDIQLARRIRGERA 171 >XP_009393405.2 PREDICTED: histone H3.2 [Musa acuminata subsp. malaccensis] Length = 163 Score = 265 bits (677), Expect = 8e-89 Identities = 138/149 (92%), Positives = 141/149 (94%) Frame = +1 Query: 43 RYPCFRSVRV*ERMARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTV 222 R P + V + MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTV Sbjct: 15 RNPNYSKVVASQSMARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTV 74 Query: 223 ALREIRKYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVSALQEAAEAYLVGLFED 402 ALREIRKYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAV+ALQEAAEAYLVGLFED Sbjct: 75 ALREIRKYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVAALQEAAEAYLVGLFED 134 Query: 403 TNLCAIHAKRVTIMPKDIQLARRIRGERA 489 TNLCAIHAKRVTIMPKDIQLARRIRGERA Sbjct: 135 TNLCAIHAKRVTIMPKDIQLARRIRGERA 163 >NP_001238509.1 uncharacterized protein LOC100306416 [Glycine max] NP_001311089.1 uncharacterized protein LOC107648867 [Zea mays] XP_003529355.1 PREDICTED: histone H3.2 [Glycine max] XP_003531787.1 PREDICTED: histone H3.2 [Glycine max] XP_003531853.1 PREDICTED: histone H3.2 [Glycine max] XP_003537953.1 PREDICTED: histone H3.2 [Glycine max] XP_003539404.1 PREDICTED: histone H3.2 [Glycine max] XP_003542714.1 PREDICTED: histone H3.2 [Glycine max] XP_003546675.1 PREDICTED: histone H3.2 [Glycine max] XP_003557185.1 PREDICTED: histone H3.2 [Brachypodium distachyon] XP_003564281.1 PREDICTED: histone H3.2 [Brachypodium distachyon] XP_003568367.1 PREDICTED: histone H3.2 [Brachypodium distachyon] XP_003575094.1 PREDICTED: histone H3.2 [Brachypodium distachyon] XP_003612856.1 core histone H2A/H2B/H3/H4 [Medicago truncatula] XP_003622981.1 core histone H2A/H2B/H3/H4 [Medicago truncatula] XP_003628691.1 core histone H2A/H2B/H3/H4 [Medicago truncatula] XP_003630185.1 core histone H2A/H2B/H3/H4 [Medicago truncatula] XP_004140867.1 PREDICTED: histone H3.2 [Cucumis sativus] XP_004488709.1 PREDICTED: histone H3.2 [Cicer arietinum] XP_004489510.1 PREDICTED: histone H3.2 [Cicer arietinum] XP_004489511.1 PREDICTED: histone H3.2 [Cicer arietinum] XP_004489512.1 PREDICTED: histone H3.2 [Cicer arietinum] XP_004489513.1 PREDICTED: histone H3.2 [Cicer arietinum] XP_004503973.1 PREDICTED: histone H3.2 [Cicer arietinum] XP_004505111.1 PREDICTED: histone H3.2 [Cicer arietinum] XP_004512510.1 PREDICTED: histone H3.2 [Cicer arietinum] XP_006383727.1 hypothetical protein POPTR_0005s25530g [Populus trichocarpa] XP_006595049.1 PREDICTED: histone H3.2 [Glycine max] XP_006597243.1 PREDICTED: histone H3.2 [Glycine max] XP_007131986.1 hypothetical protein PHAVU_011G057200g [Phaseolus vulgaris] XP_007133533.1 hypothetical protein PHAVU_011G187100g [Phaseolus vulgaris] XP_007139488.1 hypothetical protein PHAVU_008G033700g [Phaseolus vulgaris] XP_007153894.1 hypothetical protein PHAVU_003G073800g [Phaseolus vulgaris] XP_007159809.1 hypothetical protein PHAVU_002G269200g [Phaseolus vulgaris] XP_007159810.1 hypothetical protein PHAVU_002G269300g [Phaseolus vulgaris] XP_008352444.1 PREDICTED: histone H3.2 [Malus domestica] XP_008384522.1 PREDICTED: histone H3.2 [Malus domestica] XP_008384524.1 PREDICTED: histone H3.2 [Malus domestica] XP_008445689.1 PREDICTED: histone H3.2 [Cucumis melo] XP_008657023.1 PREDICTED: histone H3.2 [Zea mays] XP_008784458.1 PREDICTED: histone H3.2 [Phoenix dactylifera] XP_008785823.1 PREDICTED: histone H3.2 [Phoenix dactylifera] XP_009374750.1 PREDICTED: histone H3.2 [Pyrus x bretschneideri] XP_009379418.1 PREDICTED: histone H3.2 [Pyrus x bretschneideri] XP_009379421.1 PREDICTED: histone H3.2 [Pyrus x bretschneideri] XP_009414586.1 PREDICTED: histone H3.2 [Musa acuminata subsp. malaccensis] XP_010025543.1 PREDICTED: histone H3.2 [Eucalyptus grandis] XP_010025545.1 PREDICTED: histone H3.2 [Eucalyptus grandis] XP_010246200.1 PREDICTED: histone H3.2 [Nelumbo nucifera] XP_010231094.1 PREDICTED: histone H3.2 [Brachypodium distachyon] XP_010231492.1 PREDICTED: histone H3.2 [Brachypodium distachyon] XP_010237279.1 PREDICTED: histone H3.2 [Brachypodium distachyon] XP_010523315.1 PREDICTED: histone H3.2 [Tarenaya hassleriana] XP_010928463.1 PREDICTED: histone H3.2 [Elaeis guineensis] XP_011045162.1 PREDICTED: histone H3.2 [Populus euphratica] XP_011014732.1 PREDICTED: histone H3.2 [Populus euphratica] XP_003630195.2 core histone H2A/H2B/H3/H4 [Medicago truncatula] XP_013447325.1 core histone H2A/H2B/H3/H4 [Medicago truncatula] XP_003612851.2 core histone H2A/H2B/H3/H4 [Medicago truncatula] XP_013456228.1 core histone H2A/H2B/H3/H4 [Medicago truncatula] XP_013456925.1 core histone H2A/H2B/H3/H4 [Medicago truncatula] XP_003594840.2 core histone H2A/H2B/H3/H4 [Medicago truncatula] XP_014494055.1 PREDICTED: histone H3.2 [Vigna radiata var. radiata] XP_014497047.1 PREDICTED: histone H3.2 [Vigna radiata var. radiata] XP_014497676.1 PREDICTED: histone H3.2 [Vigna radiata var. radiata] XP_014492217.1 PREDICTED: histone H3.2 [Vigna radiata var. radiata] XP_015952173.1 PREDICTED: histone H3.2 [Arachis duranensis] XP_015935473.1 PREDICTED: histone H3.2 [Arachis duranensis] XP_015945894.1 PREDICTED: histone H3.2 [Arachis duranensis] XP_016187161.1 PREDICTED: histone H3.2 [Arachis ipaensis] XP_016171059.1 PREDICTED: histone H3.2 [Arachis ipaensis] XP_017409105.1 PREDICTED: histone H3.2 [Vigna angularis] XP_017410882.1 PREDICTED: histone H3.2 [Vigna angularis] XP_017436757.1 PREDICTED: histone H3.2 [Vigna angularis] XP_017436770.1 PREDICTED: histone H3.2 [Vigna angularis] XP_017425736.1 PREDICTED: histone H3.2 [Vigna angularis] XP_017433240.1 PREDICTED: histone H3.2 [Vigna angularis] XP_018851509.1 PREDICTED: histone H3.2 [Juglans regia] XP_018830869.1 PREDICTED: histone H3.2 [Juglans regia] XP_019434508.1 PREDICTED: histone H3.2 [Lupinus angustifolius] XP_019462708.1 PREDICTED: histone H3.2 [Lupinus angustifolius] XP_019457693.1 PREDICTED: histone H3.2 [Lupinus angustifolius] XP_019457694.1 PREDICTED: histone H3.2 [Lupinus angustifolius] XP_019463783.1 PREDICTED: histone H3.2 [Lupinus angustifolius] XP_019417246.1 PREDICTED: histone H3.2 [Lupinus angustifolius] XP_019417898.1 PREDICTED: histone H3.2 [Lupinus angustifolius] XP_019424439.1 PREDICTED: histone H3.2 [Lupinus angustifolius] XP_019437230.1 PREDICTED: histone H3.2 [Lupinus angustifolius] XP_019445693.1 PREDICTED: histone H3.2 [Lupinus angustifolius] XP_019448294.1 PREDICTED: histone H3.2 [Lupinus angustifolius] XP_020156190.1 histone H3.2 [Aegilops tauschii subsp. tauschii] XP_020176712.1 histone H3.2 [Aegilops tauschii subsp. tauschii] XP_020180106.1 histone H3.2 [Aegilops tauschii subsp. tauschii] XP_020180107.1 histone H3.2 [Aegilops tauschii subsp. tauschii] XP_020180705.1 histone H3.2 [Aegilops tauschii subsp. tauschii] XP_020181396.1 histone H3.2 [Aegilops tauschii subsp. tauschii] XP_020183600.1 histone H3.2 [Aegilops tauschii subsp. tauschii] XP_020183994.1 histone H3.2 [Aegilops tauschii subsp. tauschii] XP_020195754.1 histone H3.2 [Aegilops tauschii subsp. tauschii] XP_020199154.1 histone H3.2 [Aegilops tauschii subsp. tauschii] XP_020201310.1 histone H3.2 [Aegilops tauschii subsp. tauschii] XP_020147519.1 histone H3.2 [Aegilops tauschii subsp. tauschii] XP_020147521.1 histone H3.2 [Aegilops tauschii subsp. tauschii] XP_020148653.1 histone H3.2 [Aegilops tauschii subsp. tauschii] XP_020152971.1 histone H3.2 [Aegilops tauschii subsp. tauschii] XP_020152973.1 histone H3.2 [Aegilops tauschii subsp. tauschii] XP_020159543.1 histone H3.2 [Aegilops tauschii subsp. tauschii] XP_020164950.1 histone H3.2 [Aegilops tauschii subsp. tauschii] XP_020167501.1 histone H3.2 [Aegilops tauschii subsp. tauschii] XP_020168907.1 histone H3.2 [Aegilops tauschii subsp. tauschii] XP_020168911.1 histone H3.2 [Aegilops tauschii subsp. tauschii] XP_020168913.1 histone H3.2 [Aegilops tauschii subsp. tauschii] XP_020174885.1 histone H3.2 [Aegilops tauschii subsp. tauschii] XP_020176163.1 histone H3.2 [Aegilops tauschii subsp. tauschii] XP_020176164.1 histone H3.2 [Aegilops tauschii subsp. tauschii] XP_020176165.1 histone H3.2 [Aegilops tauschii subsp. tauschii] P68427.2 RecName: Full=Histone H3.2 P68428.2 RecName: Full=Histone H3.2 P68429.2 RecName: Full=Histone H3.2; AltName: Full=Histone H3.1; AltName: Full=Major histone H3 P68430.2 RecName: Full=Histone H3.2 CAA31964.1 unnamed protein product [Medicago sativa] CAA31965.1 unnamed protein product [Medicago sativa] CAA25451.1 unnamed protein product [Triticum aestivum] AAB49545.1 histone H3.1 [Medicago sativa] AAB81995.1 histone H3 [Onobrychis viciifolia] ACG24791.1 histone H3 [Zea mays] ACG27393.1 histone H3 [Zea mays] ACG33231.1 histone H3 [Zea mays] ACJ86155.1 unknown [Medicago truncatula] ACU14577.1 unknown [Glycine max] ACZ74621.1 histone H3-like protein [Wolffia arrhiza] ADE76568.1 unknown [Picea sitchensis] ADE76659.1 unknown [Picea sitchensis] BAK05448.1 predicted protein [Hordeum vulgare subsp. vulgare] BAJ85119.1 predicted protein [Hordeum vulgare subsp. vulgare] BAJ85969.1 predicted protein [Hordeum vulgare subsp. vulgare] BAJ88067.1 predicted protein [Hordeum vulgare subsp. vulgare] BAK07978.1 predicted protein [Hordeum vulgare subsp. vulgare] BAK01074.1 predicted protein [Hordeum vulgare subsp. vulgare] BAK04806.1 predicted protein [Hordeum vulgare subsp. vulgare] AES79199.1 core histone H2A/H2B/H3/H4 [Medicago truncatula] AES95814.1 core histone H2A/H2B/H3/H4 [Medicago truncatula] AET03167.1 core histone H2A/H2B/H3/H4 [Medicago truncatula] AET04661.1 core histone H2A/H2B/H3/H4 [Medicago truncatula] AFK40853.1 unknown [Medicago truncatula] AFK41087.1 unknown [Medicago truncatula] AFK42486.1 unknown [Medicago truncatula] AFK42592.1 unknown [Lotus japonicus] AFK43073.1 unknown [Medicago truncatula] AFK47036.1 unknown [Medicago truncatula] ERN08186.1 hypothetical protein AMTR_s00018p00168040 [Amborella trichopoda] ERP61524.1 hypothetical protein POPTR_0005s25530g [Populus trichocarpa] ESW03980.1 hypothetical protein PHAVU_011G057200g [Phaseolus vulgaris] ESW05527.1 hypothetical protein PHAVU_011G187100g [Phaseolus vulgaris] ESW11482.1 hypothetical protein PHAVU_008G033700g [Phaseolus vulgaris] ESW25888.1 hypothetical protein PHAVU_003G073800g [Phaseolus vulgaris] ESW31803.1 hypothetical protein PHAVU_002G269200g [Phaseolus vulgaris] ESW31804.1 hypothetical protein PHAVU_002G269300g [Phaseolus vulgaris] AET04671.2 core histone H2A/H2B/H3/H4 [Medicago truncatula] KEH21352.1 core histone H2A/H2B/H3/H4 [Medicago truncatula] AES95809.2 core histone H2A/H2B/H3/H4 [Medicago truncatula] KEH30259.1 core histone H2A/H2B/H3/H4 [Medicago truncatula] KEH30956.1 core histone H2A/H2B/H3/H4 [Medicago truncatula] AES65091.2 core histone H2A/H2B/H3/H4 [Medicago truncatula] CDM83919.1 unnamed protein product [Triticum aestivum] KHN21882.1 Histone H3.2 [Glycine soja] KHN30118.1 Histone H3.2 [Glycine soja] KHN34049.1 Histone H3.2 [Glycine soja] KOM28572.1 hypothetical protein LR48_Vigan553s000100 [Vigna angularis] KOM30612.1 hypothetical protein LR48_Vigan01g016600 [Vigna angularis] KOM30613.1 hypothetical protein LR48_Vigan01g016700 [Vigna angularis] KOM44347.1 hypothetical protein LR48_Vigan05g195200 [Vigna angularis] KOM50778.1 hypothetical protein LR48_Vigan08g160500 [Vigna angularis] KQJ86807.1 hypothetical protein BRADI_4g07840 [Brachypodium distachyon] KQJ99805.1 hypothetical protein BRADI_3g45290 [Brachypodium distachyon] KQK05154.1 hypothetical protein BRADI_2g18410 [Brachypodium distachyon] KQK06043.1 hypothetical protein BRADI_2g24080 [Brachypodium distachyon] KQK06659.1 hypothetical protein BRADI_2g27720 [Brachypodium distachyon] KQK19846.1 hypothetical protein BRADI_1g50820 [Brachypodium distachyon] KRH01274.1 hypothetical protein GLYMA_18G266200 [Glycine max] KRH10171.1 hypothetical protein GLYMA_15G032300 [Glycine max] KRH13201.1 hypothetical protein GLYMA_15G222200 [Glycine max] KRH20364.1 hypothetical protein GLYMA_13G173100 [Glycine max] KRH23165.1 hypothetical protein GLYMA_13G342000 [Glycine max] KRH24676.1 hypothetical protein GLYMA_12G055200 [Glycine max] KRH29676.1 hypothetical protein GLYMA_11G130900 [Glycine max] KRH44719.1 hypothetical protein GLYMA_08G227400 [Glycine max] KRH45024.1 hypothetical protein GLYMA_08G245000 [Glycine max] KRH50131.1 hypothetical protein GLYMA_07G202500 [Glycine max] KRH59532.1 hypothetical protein GLYMA_05G188600 [Glycine max] KRH59533.1 hypothetical protein GLYMA_05G188700 [Glycine max] BAT89624.1 hypothetical protein VIGAN_06062200 [Vigna angularis var. angularis] BAT90796.1 hypothetical protein VIGAN_06208200 [Vigna angularis var. angularis] BAT91809.1 hypothetical protein VIGAN_07044200 [Vigna angularis var. angularis] BAT73288.1 hypothetical protein VIGAN_01076100 [Vigna angularis var. angularis] BAT83293.1 hypothetical protein VIGAN_04042100 [Vigna angularis var. angularis] KYP58467.1 Histone H3.2 [Cajanus cajan] KYP64743.1 Histone H3.2 [Cajanus cajan] KYP68236.1 Histone H3.2 [Cajanus cajan] KYP68241.1 Histone H3.2 [Cajanus cajan] KYP68244.1 Histone H3.2 [Cajanus cajan] GAU48717.1 hypothetical protein TSUD_87150 [Trifolium subterraneum] GAU41454.1 hypothetical protein TSUD_237030 [Trifolium subterraneum] GAU41456.1 hypothetical protein TSUD_237060 [Trifolium subterraneum] GAU35062.1 hypothetical protein TSUD_69850 [Trifolium subterraneum] GAU35063.1 hypothetical protein TSUD_69860 [Trifolium subterraneum] GAU30973.1 hypothetical protein TSUD_63840 [Trifolium subterraneum] GAU26009.1 hypothetical protein TSUD_63970 [Trifolium subterraneum] GAU19848.1 hypothetical protein TSUD_170740 [Trifolium subterraneum] GAU19850.1 hypothetical protein TSUD_170760 [Trifolium subterraneum] GAU14118.1 hypothetical protein TSUD_169430 [Trifolium subterraneum] JAT65895.1 Histone H3.2 [Anthurium amnicola] OIV89496.1 hypothetical protein TanjilG_20561 [Lupinus angustifolius] OIV93236.1 hypothetical protein TanjilG_27415 [Lupinus angustifolius] OIV96988.1 hypothetical protein TanjilG_31879 [Lupinus angustifolius] OIV97129.1 hypothetical protein TanjilG_00158 [Lupinus angustifolius] OIW00460.1 hypothetical protein TanjilG_05810 [Lupinus angustifolius] OIW03732.1 hypothetical protein TanjilG_30008 [Lupinus angustifolius] OIW03733.1 hypothetical protein TanjilG_30009 [Lupinus angustifolius] OIW08957.1 hypothetical protein TanjilG_05933 [Lupinus angustifolius] OIW15358.1 hypothetical protein TanjilG_26731 [Lupinus angustifolius] OIW17835.1 hypothetical protein TanjilG_02463 [Lupinus angustifolius] AQK71552.1 Histone H3 [Zea mays] AQK99256.1 Histone H3.2 [Zea mays] Length = 136 Score = 263 bits (673), Expect = 1e-88 Identities = 136/136 (100%), Positives = 136/136 (100%) Frame = +1 Query: 82 MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVALREIRKYQKSTE 261 MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVALREIRKYQKSTE Sbjct: 1 MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVALREIRKYQKSTE 60 Query: 262 LLIRKLPFQRLVREIAQDFKTDLRFQSSAVSALQEAAEAYLVGLFEDTNLCAIHAKRVTI 441 LLIRKLPFQRLVREIAQDFKTDLRFQSSAVSALQEAAEAYLVGLFEDTNLCAIHAKRVTI Sbjct: 61 LLIRKLPFQRLVREIAQDFKTDLRFQSSAVSALQEAAEAYLVGLFEDTNLCAIHAKRVTI 120 Query: 442 MPKDIQLARRIRGERA 489 MPKDIQLARRIRGERA Sbjct: 121 MPKDIQLARRIRGERA 136 >KYP58465.1 Histone H3.2, partial [Cajanus cajan] Length = 140 Score = 263 bits (673), Expect = 1e-88 Identities = 136/136 (100%), Positives = 136/136 (100%) Frame = +1 Query: 82 MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVALREIRKYQKSTE 261 MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVALREIRKYQKSTE Sbjct: 5 MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVALREIRKYQKSTE 64 Query: 262 LLIRKLPFQRLVREIAQDFKTDLRFQSSAVSALQEAAEAYLVGLFEDTNLCAIHAKRVTI 441 LLIRKLPFQRLVREIAQDFKTDLRFQSSAVSALQEAAEAYLVGLFEDTNLCAIHAKRVTI Sbjct: 65 LLIRKLPFQRLVREIAQDFKTDLRFQSSAVSALQEAAEAYLVGLFEDTNLCAIHAKRVTI 124 Query: 442 MPKDIQLARRIRGERA 489 MPKDIQLARRIRGERA Sbjct: 125 MPKDIQLARRIRGERA 140 >JAU76986.1 Histone H3.2, partial [Noccaea caerulescens] Length = 162 Score = 264 bits (675), Expect = 2e-88 Identities = 136/142 (95%), Positives = 140/142 (98%) Frame = +1 Query: 64 VRV*ERMARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVALREIRK 243 V + ++MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVALREIRK Sbjct: 21 VSINQQMARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVALREIRK 80 Query: 244 YQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVSALQEAAEAYLVGLFEDTNLCAIH 423 YQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAV+ALQEAAEAYLVGLFEDTNLCAIH Sbjct: 81 YQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVAALQEAAEAYLVGLFEDTNLCAIH 140 Query: 424 AKRVTIMPKDIQLARRIRGERA 489 AKRVTIMPKDIQLARRIRGERA Sbjct: 141 AKRVTIMPKDIQLARRIRGERA 162 >XP_008669425.1 PREDICTED: histone H3.2-like [Zea mays] Length = 169 Score = 264 bits (675), Expect = 2e-88 Identities = 136/137 (99%), Positives = 137/137 (100%) Frame = +1 Query: 79 RMARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVALREIRKYQKST 258 RMARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVALREIRKYQKST Sbjct: 33 RMARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVALREIRKYQKST 92 Query: 259 ELLIRKLPFQRLVREIAQDFKTDLRFQSSAVSALQEAAEAYLVGLFEDTNLCAIHAKRVT 438 ELLIRKLPFQRLVREIAQDFKTDLRFQSSAV+ALQEAAEAYLVGLFEDTNLCAIHAKRVT Sbjct: 93 ELLIRKLPFQRLVREIAQDFKTDLRFQSSAVAALQEAAEAYLVGLFEDTNLCAIHAKRVT 152 Query: 439 IMPKDIQLARRIRGERA 489 IMPKDIQLARRIRGERA Sbjct: 153 IMPKDIQLARRIRGERA 169 >XP_020195127.1 histone H3.2-like [Aegilops tauschii subsp. tauschii] Length = 136 Score = 263 bits (671), Expect = 3e-88 Identities = 135/136 (99%), Positives = 136/136 (100%) Frame = +1 Query: 82 MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVALREIRKYQKSTE 261 MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVALREIRKYQKSTE Sbjct: 1 MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVALREIRKYQKSTE 60 Query: 262 LLIRKLPFQRLVREIAQDFKTDLRFQSSAVSALQEAAEAYLVGLFEDTNLCAIHAKRVTI 441 LLIRKLPFQRLVREIAQDFKTDLRFQSSAVSALQEAAEAYLVG+FEDTNLCAIHAKRVTI Sbjct: 61 LLIRKLPFQRLVREIAQDFKTDLRFQSSAVSALQEAAEAYLVGMFEDTNLCAIHAKRVTI 120 Query: 442 MPKDIQLARRIRGERA 489 MPKDIQLARRIRGERA Sbjct: 121 MPKDIQLARRIRGERA 136 >XP_020168912.1 histone H3.2-like [Aegilops tauschii subsp. tauschii] Length = 136 Score = 262 bits (670), Expect = 4e-88 Identities = 135/136 (99%), Positives = 136/136 (100%) Frame = +1 Query: 82 MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVALREIRKYQKSTE 261 MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVALREIRKYQKSTE Sbjct: 1 MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVALREIRKYQKSTE 60 Query: 262 LLIRKLPFQRLVREIAQDFKTDLRFQSSAVSALQEAAEAYLVGLFEDTNLCAIHAKRVTI 441 LLIRKLPFQRLVREIAQDFKTDLRFQSSAVSALQ+AAEAYLVGLFEDTNLCAIHAKRVTI Sbjct: 61 LLIRKLPFQRLVREIAQDFKTDLRFQSSAVSALQDAAEAYLVGLFEDTNLCAIHAKRVTI 120 Query: 442 MPKDIQLARRIRGERA 489 MPKDIQLARRIRGERA Sbjct: 121 MPKDIQLARRIRGERA 136 >XP_019199849.1 PREDICTED: histone H3.2-like [Ipomoea nil] Length = 136 Score = 262 bits (670), Expect = 4e-88 Identities = 135/136 (99%), Positives = 136/136 (100%) Frame = +1 Query: 82 MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVALREIRKYQKSTE 261 MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVALREIRKYQKSTE Sbjct: 1 MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVALREIRKYQKSTE 60 Query: 262 LLIRKLPFQRLVREIAQDFKTDLRFQSSAVSALQEAAEAYLVGLFEDTNLCAIHAKRVTI 441 LLIRKLPFQRLVREIAQDFKTDLRFQSSAVSALQEAAEAYLVGLFEDTNLCAIHAKRVTI Sbjct: 61 LLIRKLPFQRLVREIAQDFKTDLRFQSSAVSALQEAAEAYLVGLFEDTNLCAIHAKRVTI 120 Query: 442 MPKDIQLARRIRGERA 489 MPKD+QLARRIRGERA Sbjct: 121 MPKDMQLARRIRGERA 136 >NP_189372.1 Histone superfamily protein [Arabidopsis thaliana] NP_201339.1 Histone superfamily protein [Arabidopsis thaliana] NP_563838.1 Histone superfamily protein [Arabidopsis thaliana] NP_568227.1 Histone superfamily protein [Arabidopsis thaliana] NP_568228.1 Histone superfamily protein [Arabidopsis thaliana] NP_001131276.1 histone H3.2 [Zea mays] XP_002299242.1 histone H3 family protein [Populus trichocarpa] XP_002304754.1 hypothetical protein POPTR_0003s22120g [Populus trichocarpa] XP_002282606.1 PREDICTED: histone H3.2 [Vitis vinifera] XP_002285556.1 PREDICTED: histone H3.2 [Vitis vinifera] XP_002285562.1 PREDICTED: histone H3.2 [Vitis vinifera] XP_002264961.1 PREDICTED: histone H3.2 [Vitis vinifera] XP_002457320.1 hypothetical protein SORBIDRAFT_03g005550 [Sorghum bicolor] XP_002452234.1 hypothetical protein SORBIDRAFT_04g022160 [Sorghum bicolor] XP_002446458.1 hypothetical protein SORBIDRAFT_06g016330 [Sorghum bicolor] XP_002447846.1 hypothetical protein SORBIDRAFT_06g016850 [Sorghum bicolor] XP_002441172.1 hypothetical protein SORBIDRAFT_09g021650 [Sorghum bicolor] XP_002436522.1 hypothetical protein SORBIDRAFT_10g004110 [Sorghum bicolor] XP_002437869.1 hypothetical protein SORBIDRAFT_10g004100 [Sorghum bicolor] XP_002522502.1 PREDICTED: histone H3.2 [Ricinus communis] XP_002524630.1 PREDICTED: histone H3.2 [Ricinus communis] XP_002533558.1 PREDICTED: histone H3.2 [Ricinus communis] XP_002533561.1 PREDICTED: histone H3.2 [Ricinus communis] XP_002533563.1 PREDICTED: histone H3.2 [Ricinus communis] XP_002533564.1 PREDICTED: histone H3.2 [Ricinus communis] XP_002873454.1 histone H3 [Arabidopsis lyrata subsp. lyrata] XP_002873455.1 histone H3 [Arabidopsis lyrata subsp. lyrata] XP_002877045.1 histone H3 [Arabidopsis lyrata subsp. lyrata] XP_002892490.1 histone H3 [Arabidopsis lyrata subsp. lyrata] XP_002894648.1 histone H3 [Arabidopsis lyrata subsp. lyrata] XP_004142133.1 PREDICTED: histone H3.2 [Cucumis sativus] XP_004229355.1 PREDICTED: histone H3.2 [Solanum lycopersicum] XP_004229356.1 PREDICTED: histone H3.2 [Solanum lycopersicum] XP_004229488.1 PREDICTED: histone H3.2 [Solanum lycopersicum] XP_004248123.1 PREDICTED: histone H3.2 [Solanum lycopersicum] XP_004293906.1 PREDICTED: histone H3.2 [Fragaria vesca subsp. vesca] XP_004294584.1 PREDICTED: histone H3.2 [Fragaria vesca subsp. vesca] XP_004294793.1 PREDICTED: histone H3.2 [Fragaria vesca subsp. vesca] XP_004295221.1 PREDICTED: histone H3.2 [Fragaria vesca subsp. vesca] XP_004300433.1 PREDICTED: histone H3.2 [Fragaria vesca subsp. vesca] XP_004952690.1 PREDICTED: histone H3.2 [Setaria italica] XP_004970697.1 PREDICTED: histone H3.2 [Setaria italica] XP_004975679.1 PREDICTED: histone H3.2 [Setaria italica] XP_006359169.1 PREDICTED: histone H3.2 [Solanum tuberosum] XP_006359170.1 PREDICTED: histone H3.2 [Solanum tuberosum] XP_006361042.1 PREDICTED: histone H3.2 [Solanum tuberosum] XP_006364319.1 PREDICTED: histone H3.2 [Solanum tuberosum] XP_006365266.1 PREDICTED: histone H3.2 [Solanum tuberosum] XP_006366504.1 PREDICTED: histone H3.2 [Solanum tuberosum] XP_006366505.1 PREDICTED: histone H3.2 [Solanum tuberosum] XP_006289123.1 hypothetical protein CARUB_v10002544mg [Capsella rubella] XP_006289801.1 hypothetical protein CARUB_v10003405mg [Capsella rubella] XP_006292533.1 hypothetical protein CARUB_v10018763mg [Capsella rubella] XP_006304637.1 hypothetical protein CARUB_v10011755mg [Capsella rubella] XP_006386195.1 hypothetical protein POPTR_0002s03030g [Populus trichocarpa] XP_006386111.1 hypothetical protein POPTR_0003s22240g [Populus trichocarpa] XP_002320408.2 hypothetical protein POPTR_0014s09260g [Populus trichocarpa] XP_006394044.1 hypothetical protein EUTSA_v10005111mg [Eutrema salsugineum] XP_006394194.1 hypothetical protein EUTSA_v10005114mg [Eutrema salsugineum] XP_006396911.1 hypothetical protein EUTSA_v10029057mg [Eutrema salsugineum] XP_006399532.1 hypothetical protein EUTSA_v10014986mg [Eutrema salsugineum] XP_006399534.1 hypothetical protein EUTSA_v10014985mg [Eutrema salsugineum] XP_006426310.1 hypothetical protein CICLE_v10026742mg [Citrus clementina] XP_006446007.1 hypothetical protein CICLE_v10017132mg [Citrus clementina] XP_006446012.1 hypothetical protein CICLE_v10017131mg [Citrus clementina] XP_006446027.1 hypothetical protein CICLE_v10017133mg [Citrus clementina] XP_006466277.1 PREDICTED: histone H3.2 [Citrus sinensis] XP_006493650.1 PREDICTED: histone H3.2 [Citrus sinensis] XP_006493653.1 PREDICTED: histone H3.2 isoform X1 [Citrus sinensis] XP_006493654.1 PREDICTED: histone H3.2 isoform X2 [Citrus sinensis] XP_006493658.1 PREDICTED: histone H3.2 isoform X1 [Citrus sinensis] XP_006493659.1 PREDICTED: histone H3.2 isoform X2 [Citrus sinensis] XP_006656199.1 PREDICTED: histone H3.2 [Oryza brachyantha] XP_006662745.1 PREDICTED: histone H3.2 [Oryza brachyantha] XP_006827607.1 PREDICTED: histone H3.2 [Amborella trichopoda] XP_006854535.1 PREDICTED: histone H3.2 [Amborella trichopoda] XP_007014937.1 PREDICTED: histone H3.2 [Theobroma cacao] XP_007047838.1 PREDICTED: histone H3.2 [Theobroma cacao] XP_007206130.1 hypothetical protein PRUPE_ppa013165mg [Prunus persica] XP_007206131.1 hypothetical protein PRUPE_ppa013174mg [Prunus persica] XP_007213974.1 hypothetical protein PRUPE_ppa013173mg [Prunus persica] XP_008219239.1 PREDICTED: histone H3.2 [Prunus mume] XP_008219284.1 PREDICTED: histone H3.2 [Prunus mume] XP_008243610.1 PREDICTED: histone H3.2 [Prunus mume] XP_008245364.1 PREDICTED: histone H3.2 [Prunus mume] XP_008383674.1 PREDICTED: histone H3.2 [Malus domestica] XP_008384460.1 PREDICTED: histone H3.2 [Malus domestica] XP_008384469.1 PREDICTED: histone H3.2 [Malus domestica] XP_008349461.1 PREDICTED: histone H3.2 [Malus domestica] XP_008358867.1 PREDICTED: histone H3.2 [Malus domestica] XP_008366176.1 PREDICTED: histone H3.2 [Malus domestica] XP_008449740.1 PREDICTED: histone H3.2 [Cucumis melo] XP_008466947.1 PREDICTED: histone H3.2 [Cucumis melo] XP_008678686.1 PREDICTED: histone H3.2 [Zea mays] XP_008659267.1 PREDICTED: histone H3.2 [Zea mays] XP_008777421.1 PREDICTED: histone H3.2 [Phoenix dactylifera] XP_008781402.1 PREDICTED: histone H3.2 [Phoenix dactylifera] XP_008793940.1 PREDICTED: histone H3.2 [Phoenix dactylifera] XP_009125303.1 PREDICTED: histone H3.2 [Brassica rapa] XP_009131154.1 PREDICTED: histone H3.2 [Brassica rapa] XP_009110843.1 PREDICTED: histone H3.2 [Brassica rapa] XP_009112178.1 PREDICTED: histone H3.2 [Brassica rapa] XP_009114048.1 PREDICTED: histone H3.2 [Brassica rapa] XP_009374897.1 PREDICTED: histone H3.2 [Pyrus x bretschneideri] XP_009352838.1 PREDICTED: histone H3.2 [Pyrus x bretschneideri] XP_009364707.1 PREDICTED: histone H3.2 [Pyrus x bretschneideri] XP_009364738.1 PREDICTED: histone H3.2 [Pyrus x bretschneideri] XP_009379413.1 PREDICTED: histone H3.2 [Pyrus x bretschneideri] XP_009418349.1 PREDICTED: histone H3.2 [Musa acuminata subsp. malaccensis] XP_009399186.1 PREDICTED: histone H3.2 [Musa acuminata subsp. malaccensis] XP_009404906.1 PREDICTED: histone H3.2 [Musa acuminata subsp. malaccensis] XP_009405329.1 PREDICTED: histone H3.2 [Musa acuminata subsp. malaccensis] XP_009411937.1 PREDICTED: histone H3.2 [Musa acuminata subsp. malaccensis] XP_009420590.1 PREDICTED: histone H3.2 [Musa acuminata subsp. malaccensis] XP_009612389.1 PREDICTED: histone H3.2 [Nicotiana tomentosiformis] XP_009588612.1 PREDICTED: histone H3.2 [Nicotiana tomentosiformis] XP_009588620.1 PREDICTED: histone H3.2 [Nicotiana tomentosiformis] XP_009589159.1 PREDICTED: histone H3.2 [Nicotiana tomentosiformis] XP_009594168.1 PREDICTED: histone H3.2 [Nicotiana tomentosiformis] XP_009597397.1 PREDICTED: histone H3.2 [Nicotiana tomentosiformis] XP_009795193.1 PREDICTED: histone H3.2 [Nicotiana sylvestris] XP_009790377.1 PREDICTED: histone H3.2 [Nicotiana sylvestris] XP_009792014.1 PREDICTED: histone H3.2 [Nicotiana sylvestris] XP_009794411.1 PREDICTED: histone H3.2 [Nicotiana sylvestris] XP_009794577.1 PREDICTED: histone H3.2 [Nicotiana sylvestris] XP_009800087.1 PREDICTED: histone H3.2 [Nicotiana sylvestris] XP_009768852.1 PREDICTED: histone H3.2 [Nicotiana sylvestris] XP_009776512.1 PREDICTED: histone H3.2 [Nicotiana sylvestris] XP_010044997.1 PREDICTED: histone H3.2 [Eucalyptus grandis] XP_010031842.1 PREDICTED: histone H3.2 [Eucalyptus grandis] XP_010033130.1 PREDICTED: histone H3.2 [Eucalyptus grandis] XP_010087371.1 Histone [Morus notabilis] XP_010087372.1 Histone [Morus notabilis] XP_010091983.1 Histone [Morus notabilis] XP_010091985.1 Histone [Morus notabilis] XP_010111157.1 Histone [Morus notabilis] XP_010257371.1 PREDICTED: histone H3.2 [Nelumbo nucifera] XP_010257381.1 PREDICTED: histone H3.2 [Nelumbo nucifera] XP_010258545.1 PREDICTED: histone H3.2 [Nelumbo nucifera] XP_010260368.1 PREDICTED: histone H3.2 [Nelumbo nucifera] XP_010260930.1 PREDICTED: histone H3.2 [Nelumbo nucifera] XP_010263130.1 PREDICTED: histone H3.2 [Nelumbo nucifera] XP_010265797.1 PREDICTED: histone H3.2 [Nelumbo nucifera] XP_010241721.1 PREDICTED: histone H3.2 [Nelumbo nucifera] XP_010324306.1 PREDICTED: histone H3.2 [Solanum lycopersicum] XP_010316780.1 PREDICTED: histone H3.2 [Solanum lycopersicum] XP_010463183.1 PREDICTED: histone H3.2 [Camelina sativa] XP_010489841.1 PREDICTED: histone H3.2 [Camelina sativa] XP_010502711.1 PREDICTED: histone H3.2 [Camelina sativa] XP_010514443.1 PREDICTED: histone H3.2 [Camelina sativa] XP_010425488.1 PREDICTED: histone H3.2 [Camelina sativa] XP_010444536.1 PREDICTED: histone H3.2 [Camelina sativa] XP_010458200.1 PREDICTED: histone H3.2 [Camelina sativa] XP_010475747.1 PREDICTED: histone H3.2 [Camelina sativa] XP_010484375.1 PREDICTED: histone H3.2 [Camelina sativa] XP_010536065.1 PREDICTED: histone H3.2 [Tarenaya hassleriana] XP_010544196.1 PREDICTED: histone H3.2 [Tarenaya hassleriana] XP_010673587.1 PREDICTED: histone H3.2 [Beta vulgaris subsp. vulgaris] XP_010673590.1 PREDICTED: histone H3.2 [Beta vulgaris subsp. vulgaris] XP_010675450.1 PREDICTED: histone H3.2 [Beta vulgaris subsp. vulgaris] XP_010675457.1 PREDICTED: histone H3.2 [Beta vulgaris subsp. vulgaris] XP_010675458.1 PREDICTED: histone H3.2 [Beta vulgaris subsp. vulgaris] XP_010679903.1 PREDICTED: histone H3.2 [Beta vulgaris subsp. vulgaris] XP_010911970.1 PREDICTED: histone H3.2 [Elaeis guineensis] XP_010912408.1 PREDICTED: histone H3.2 [Elaeis guineensis] XP_011037963.1 PREDICTED: histone H3.2 [Populus euphratica] XP_010930992.1 PREDICTED: histone H3.2 [Elaeis guineensis] XP_011028938.1 PREDICTED: histone H3.2 [Populus euphratica] XP_010904890.1 PREDICTED: histone H3.2 [Elaeis guineensis] XP_011037873.1 PREDICTED: histone H3.2 [Populus euphratica] XP_011037877.1 PREDICTED: histone H3.2 [Populus euphratica] XP_011042066.1 PREDICTED: histone H3.2 [Populus euphratica] XP_011042070.1 PREDICTED: histone H3.2 [Populus euphratica] XP_011087280.1 PREDICTED: histone H3.2 [Sesamum indicum] XP_011080254.1 PREDICTED: histone H3.2 [Sesamum indicum] XP_011090392.1 PREDICTED: histone H3.2 [Sesamum indicum] XP_011092467.1 PREDICTED: histone H3.2 [Sesamum indicum] XP_011093538.1 PREDICTED: histone H3.2 [Sesamum indicum] XP_011463287.1 PREDICTED: histone H3.2 [Fragaria vesca subsp. vesca] XP_004139024.2 PREDICTED: histone H3.2 [Cucumis sativus] XP_012071958.1 PREDICTED: histone H3.2 [Jatropha curcas] XP_012091683.1 PREDICTED: histone H3.2 [Jatropha curcas] XP_012092773.1 PREDICTED: histone H3.2 [Jatropha curcas] XP_012092775.1 PREDICTED: histone H3.2 [Jatropha curcas] XP_012473340.1 PREDICTED: histone H3.2 [Gossypium raimondii] XP_012477143.1 PREDICTED: histone H3.2 [Gossypium raimondii] XP_012477145.1 PREDICTED: histone H3.2 [Gossypium raimondii] XP_012447072.1 PREDICTED: histone H3.2 [Gossypium raimondii] XP_012452274.1 PREDICTED: histone H3.2 [Gossypium raimondii] XP_012455372.1 PREDICTED: histone H3.2 [Gossypium raimondii] XP_012456013.1 PREDICTED: histone H3.2 [Gossypium raimondii] XP_012464460.1 PREDICTED: histone H3.2 [Gossypium raimondii] XP_012465103.1 PREDICTED: histone H3.2 [Gossypium raimondii] XP_012700296.1 PREDICTED: histone H3.2 [Setaria italica] XP_012700964.1 PREDICTED: histone H3.2 [Setaria italica] XP_012829914.1 PREDICTED: histone H3.2 [Erythranthe guttata] XP_012830336.1 PREDICTED: histone H3.2 [Erythranthe guttata] XP_012835372.1 PREDICTED: histone H3.2 [Erythranthe guttata] XP_012849881.1 PREDICTED: histone H3.2 [Erythranthe guttata] XP_012828407.1 PREDICTED: histone H3.2 [Erythranthe guttata] XP_012829025.1 PREDICTED: histone H3.2 [Erythranthe guttata] XP_013618388.1 PREDICTED: histone H3.2 [Brassica oleracea var. oleracea] XP_013621521.1 PREDICTED: histone H3.2 [Brassica oleracea var. oleracea] XP_013637372.1 PREDICTED: histone H3.2 [Brassica oleracea var. oleracea] XP_013599938.1 PREDICTED: histone H3.2 [Brassica oleracea var. oleracea] XP_013606481.1 PREDICTED: histone H3.2 [Brassica oleracea var. oleracea] XP_013609086.1 PREDICTED: histone H3.2 [Brassica oleracea var. oleracea] XP_013678750.1 PREDICTED: histone H3.2 [Brassica napus] XP_013726586.1 PREDICTED: histone H3.2 [Brassica napus] XP_013738537.1 PREDICTED: histone H3.2 [Brassica napus] XP_013742827.1 PREDICTED: histone H3.2 [Brassica napus] XP_013742828.1 PREDICTED: histone H3.2 [Brassica napus] XP_013750874.1 PREDICTED: histone H3.2 [Brassica napus] XP_013657686.1 PREDICTED: histone H3.2 [Brassica napus] XP_013677697.1 PREDICTED: histone H3.2 [Brassica napus] XP_013680280.1 PREDICTED: histone H3.2 [Brassica napus] XP_013686742.1 PREDICTED: histone H3.2 [Brassica napus] XP_013686753.1 PREDICTED: histone H3.2 [Brassica napus] XP_013698649.1 PREDICTED: histone H3.2 [Brassica napus] XP_013700674.1 PREDICTED: histone H3.2 [Brassica napus] XP_013700675.1 PREDICTED: histone H3.2 [Brassica napus] XP_013700676.1 PREDICTED: histone H3.2 [Brassica napus] XP_013712760.1 PREDICTED: histone H3.2 [Brassica napus] XP_013718218.1 PREDICTED: histone H3.2 [Brassica napus] XP_013718219.1 PREDICTED: histone H3.2 [Brassica napus] XP_013731494.1 PREDICTED: histone H3.2 [Brassica napus] XP_013733475.1 PREDICTED: histone H3.2 [Brassica napus] XP_014660475.1 PREDICTED: histone H3.2 [Setaria italica] XP_015062471.1 PREDICTED: histone H3.2 [Solanum pennellii] XP_015062551.1 PREDICTED: histone H3.2 [Solanum pennellii] XP_015060267.1 PREDICTED: histone H3.2 [Solanum pennellii] XP_015060270.1 PREDICTED: histone H3.2 [Solanum pennellii] XP_015063022.1 PREDICTED: histone H3.2 [Solanum pennellii] XP_015063120.1 PREDICTED: histone H3.2 [Solanum pennellii] XP_015066930.1 PREDICTED: histone H3.2 [Solanum pennellii] XP_015088813.1 PREDICTED: histone H3.2 [Solanum pennellii] XP_015641515.1 PREDICTED: histone H3.2 [Oryza sativa Japonica Group] XP_015639714.1 PREDICTED: histone H3.2 [Oryza sativa Japonica Group] XP_015642925.1 PREDICTED: histone H3.2 [Oryza sativa Japonica Group] XP_015642926.1 PREDICTED: histone H3.2 [Oryza sativa Japonica Group] XP_015642927.1 PREDICTED: histone H3.2 [Oryza sativa Japonica Group] XP_015615109.1 PREDICTED: histone H3.2 [Oryza sativa Japonica Group] XP_015890987.1 PREDICTED: histone H3.2 [Ziziphus jujuba] XP_015875930.1 PREDICTED: histone H3.2 [Ziziphus jujuba] XP_015867123.1 PREDICTED: histone H3.2 [Ziziphus jujuba] XP_015867128.1 PREDICTED: histone H3.2 [Ziziphus jujuba] XP_015956408.1 PREDICTED: histone H3.2 [Arachis duranensis] XP_015962680.1 PREDICTED: histone H3.2 [Arachis duranensis] XP_015945242.1 PREDICTED: histone H3.2 [Arachis duranensis] XP_016190032.1 PREDICTED: histone H3.2 [Arachis ipaensis] XP_016194363.1 PREDICTED: histone H3.2 [Arachis ipaensis] XP_016181780.1 PREDICTED: histone H3.2 [Arachis ipaensis] XP_016182163.1 PREDICTED: histone H3.2 [Arachis ipaensis] XP_016444277.1 PREDICTED: histone H3.2 [Nicotiana tabacum] XP_016472604.1 PREDICTED: histone H3.2 [Nicotiana tabacum] XP_016476898.1 PREDICTED: histone H3.2 [Nicotiana tabacum] XP_016497746.1 PREDICTED: histone H3.2 [Nicotiana tabacum] XP_016497344.1 PREDICTED: histone H3.2 [Nicotiana tabacum] XP_016498067.1 PREDICTED: histone H3.2 [Nicotiana tabacum] XP_016498068.1 PREDICTED: histone H3.2 [Nicotiana tabacum] XP_016500339.1 PREDICTED: histone H3.2 [Nicotiana tabacum] XP_016502252.1 PREDICTED: histone H3.2 [Nicotiana tabacum] XP_016506905.1 PREDICTED: histone H3.2 [Nicotiana tabacum] XP_016432905.1 PREDICTED: histone H3.2 [Nicotiana tabacum] XP_016437038.1 PREDICTED: histone H3.2 [Nicotiana tabacum] XP_016514570.1 PREDICTED: histone H3.2 [Nicotiana tabacum] XP_016432553.1 PREDICTED: histone H3.2 [Nicotiana tabacum] XP_016438522.1 PREDICTED: histone H3.2 [Nicotiana tabacum] XP_016554942.1 PREDICTED: histone H3.2 [Capsicum annuum] XP_016557393.1 PREDICTED: histone H3.2 [Capsicum annuum] XP_016557394.1 PREDICTED: histone H3.2 [Capsicum annuum] XP_016541463.1 PREDICTED: histone H3.2 [Capsicum annuum] XP_016559802.1 PREDICTED: histone H3.2 [Capsicum annuum] XP_016551871.1 PREDICTED: histone H3.2 [Capsicum annuum] XP_016717625.1 PREDICTED: histone H3.2 [Gossypium hirsutum] XP_016734760.1 PREDICTED: histone H3.2 [Gossypium hirsutum] XP_016753413.1 PREDICTED: histone H3.2 [Gossypium hirsutum] XP_016678479.1 PREDICTED: histone H3.2 [Gossypium hirsutum] XP_016679592.1 PREDICTED: histone H3.2 [Gossypium hirsutum] XP_016683567.1 PREDICTED: histone H3.2 [Gossypium hirsutum] XP_016690176.1 PREDICTED: histone H3.2 [Gossypium hirsutum] XP_016697979.1 PREDICTED: histone H3.2 [Gossypium hirsutum] XP_016698756.1 PREDICTED: histone H3.2 [Gossypium hirsutum] XP_016703464.1 PREDICTED: histone H3.2 [Gossypium hirsutum] XP_016706622.1 PREDICTED: histone H3.2 [Gossypium hirsutum] XP_017182452.1 PREDICTED: histone H3.2 [Malus domestica] XP_017185745.1 PREDICTED: histone H3.2 [Malus domestica] XP_017234420.1 PREDICTED: histone H3.2 [Daucus carota subsp. sativus] XP_017236362.1 PREDICTED: histone H3.2 [Daucus carota subsp. sativus] XP_017258634.1 PREDICTED: histone H3.2 [Daucus carota subsp. sativus] XP_017232071.1 PREDICTED: histone H3.2 [Daucus carota subsp. sativus] XP_017234599.1 PREDICTED: histone H3.2 [Daucus carota subsp. sativus] XP_017234600.1 PREDICTED: histone H3.2 [Daucus carota subsp. sativus] XP_017226888.1 PREDICTED: histone H3.2 [Daucus carota subsp. sativus] XP_017621199.1 PREDICTED: histone H3.2 [Gossypium arboreum] XP_017605698.1 PREDICTED: histone H3.2 [Gossypium arboreum] XP_017643103.1 PREDICTED: histone H3.2 [Gossypium arboreum] XP_017646801.1 PREDICTED: histone H3.2 [Gossypium arboreum] XP_017648889.1 PREDICTED: histone H3.2 [Gossypium arboreum] XP_017980785.1 PREDICTED: histone H3.2 [Theobroma cacao] XP_017981975.1 PREDICTED: histone H3.2 [Theobroma cacao] XP_007014942.2 PREDICTED: histone H3.2 [Theobroma cacao] XP_018470661.1 PREDICTED: histone H3.2 [Raphanus sativus] XP_018470662.1 PREDICTED: histone H3.2 [Raphanus sativus] XP_018433979.1 PREDICTED: histone H3.2 [Raphanus sativus] XP_018439713.1 PREDICTED: histone H3.2 [Raphanus sativus] XP_018445234.1 PREDICTED: histone H3.2 [Raphanus sativus] XP_018448989.1 PREDICTED: histone H3.2 [Raphanus sativus] XP_018448990.1 PREDICTED: histone H3.2 [Raphanus sativus] XP_018456938.1 PREDICTED: histone H3.2 [Raphanus sativus] XP_018456939.1 PREDICTED: histone H3.2 [Raphanus sativus] XP_018622827.1 PREDICTED: histone H3.2 [Nicotiana tomentosiformis] XP_018727385.1 PREDICTED: histone H3.2 [Eucalyptus grandis] XP_018851506.1 PREDICTED: histone H3.2 [Juglans regia] XP_019059186.1 PREDICTED: histone H3.2 [Tarenaya hassleriana] XP_019072373.1 PREDICTED: histone H3.2 [Vitis vinifera] XP_019186829.1 PREDICTED: histone H3.2 [Ipomoea nil] XP_019152654.1 PREDICTED: histone H3.2 [Ipomoea nil] XP_019152661.1 PREDICTED: histone H3.2 [Ipomoea nil] XP_019152669.1 PREDICTED: histone H3.2 [Ipomoea nil] XP_019168898.1 PREDICTED: histone H3.2 [Ipomoea nil] XP_019197722.1 PREDICTED: histone H3.2 [Ipomoea nil] XP_019168634.1 PREDICTED: histone H3.2 [Ipomoea nil] XP_019265433.1 PREDICTED: histone H3.2 [Nicotiana attenuata] XP_019267355.1 PREDICTED: histone H3.2 [Nicotiana attenuata] XP_019223782.1 PREDICTED: histone H3.2 [Nicotiana attenuata] XP_019223783.1 PREDICTED: histone H3.2 [Nicotiana attenuata] XP_019230430.1 PREDICTED: histone H3.2 [Nicotiana attenuata] XP_019241236.1 PREDICTED: histone H3.2 [Nicotiana attenuata] XP_019226053.1 PREDICTED: histone H3.2 [Nicotiana attenuata] XP_019246841.1 PREDICTED: histone H3.2 [Nicotiana attenuata] XP_019578994.1 PREDICTED: histone H3.2 [Rhinolophus sinicus] XP_019579013.1 PREDICTED: histone H3.2 [Rhinolophus sinicus] XP_019579046.1 PREDICTED: histone H3.2 [Rhinolophus sinicus] XP_019579062.1 PREDICTED: histone H3.2 [Rhinolophus sinicus] XP_020089911.1 histone H3.2 [Ananas comosus] XP_020090239.1 histone H3.2 [Ananas comosus] XP_020111776.1 histone H3.2 [Ananas comosus] P59226.2 RecName: Full=Histone H3.2; AltName: Full=Histone H3.1 P69246.2 RecName: Full=Histone H3.2 P69248.2 RecName: Full=Histone H3.2 Q71T45.3 RecName: Full=Histone H3.2 Q6LBE3.3 RecName: Full=Histone H3.2 Q6LCK1.3 RecName: Full=Histone H3.2 Q76MV0.1 RecName: Full=Histone H3.2 Q2RAD9.1 RecName: Full=Histone H3.2 A2Y533.1 RecName: Full=Histone H3.2 AAF64452.1 histone H3 [Euphorbia esula] AAK49583.1 histone H3 [Arabidopsis thaliana] CAA31969.1 unnamed protein product [Oryza sativa] CAA31970.1 unnamed protein product [Oryza sativa] AAA33471.1 histone H3 (H3C3) [Zea mays] AAA33472.1 histone H3 [Zea mays] AAA33473.1 histone H3 [Zea mays] AAA66265.1 histone H3 [Zea mays] AAA33852.1 histone H3 [Petroselinum crispum] AAA33853.1 histone H3 [Petroselinum crispum] AAA33854.1 histone H3 [Petroselinum crispum] AAA32808.1 histone H3 [Arabidopsis thaliana] AAA32809.1 histone H3 [Arabidopsis thaliana] CAA59111.1 histone 3 [Zea mays] AAA79889.1 histone H3 [Arabidopsis thaliana] AAB67837.1 histone H3 homolog [Brassica napus] CAA57811.1 Histone H3 [Asparagus officinalis] AAB18816.1 histone 3 [Oryza sativa Indica Group] AAC24084.1 Match to histone H3 gene gb|M17131 and gb|M35387 from A. thaliana. ESTs gb|H76511 gb|H76255, gb|AA712452, gb|N65260 and gb|T42306 come from this gene [Arabidopsis thaliana] BAA81840.1 histone H3 [Oryza sativa Japonica Group] BAA81841.1 histone H3 [Oryza sativa Japonica Group] CAB89403.1 histone H3-like protein [Arabidopsis thaliana] CAB89404.1 histone H3-like protein [Arabidopsis thaliana] BAA95712.1 histone H3-like protein [Arabidopsis thaliana] BAB11558.1 histone H3 [Arabidopsis thaliana] AAK59851.1 AT3g27360/K1G2_6 [Arabidopsis thaliana] AAK64008.1 AT5g65360/MNA5_9 [Arabidopsis thaliana] AAL76132.1 AT3g27360/K1G2_6 [Arabidopsis thaliana] AAL87394.1 AT5g65360/MNA5_9 [Arabidopsis thaliana] AAM60903.1 histone H3-like protein [Arabidopsis thaliana] BAC01212.1 histone H3 [Oryza sativa Japonica Group] AAM95675.1 histone H3 [Orobanche cernua var. cumana] BAC41835.1 putative histone H3 [Arabidopsis thaliana] BAC53942.1 H3 histone [Nicotiana tabacum] AAO23616.1 At5g10400 [Arabidopsis thaliana] AAO24594.1 At1g09200 [Arabidopsis thaliana] AAO64207.1 putative histone H3 [Arabidopsis thaliana] AAP04053.1 putative histone H3 [Arabidopsis thaliana] CAE02924.1 OSJNBb0108J11.17 [Oryza sativa Japonica Group] AAT07615.1 putative histone H3 [Oryza sativa Japonica Group] BAD46448.1 histone H3 [Oryza sativa Japonica Group] BAD46453.1 histone H3 [Oryza sativa Japonica Group] BAD46454.1 histone H3 [Oryza sativa Japonica Group] AAX92719.1 histone H3 - maize [Oryza sativa Japonica Group] AAZ66939.1 117M18_20 [Brassica rapa] ABA91537.2 Histone H3, putative, expressed [Oryza sativa Japonica Group] BAF00340.1 histone H3 like protein [Arabidopsis thaliana] BAE99603.1 histone H3 like protein [Arabidopsis thaliana] BAE99643.1 histone H3 like protein [Arabidopsis thaliana] BAF06818.1 Os01g0866200 [Oryza sativa Japonica Group] BAF14690.1 Os04g0419600 [Oryza sativa Japonica Group] BAF17574.1 Os05g0438700 [Oryza sativa Japonica Group] BAF18791.1 Os06g0160100 [Oryza sativa Japonica Group] BAF27636.1 Os11g0155900 [Oryza sativa Japonica Group] ABK21761.1 unknown [Picea sitchensis] ABK25492.1 unknown [Picea sitchensis] ABK92858.1 unknown [Populus trichocarpa] ABK93905.1 unknown [Populus trichocarpa] ABK93950.1 unknown [Populus trichocarpa] ABK95888.1 unknown [Populus trichocarpa] EAY80005.1 hypothetical protein OsI_35174 [Oryza sativa Indica Group] EAY98193.1 hypothetical protein OsI_20106 [Oryza sativa Indica Group] EAY99776.1 hypothetical protein OsI_21763 [Oryza sativa Indica Group] EAY99779.1 hypothetical protein OsI_21766 [Oryza sativa Indica Group] EAZ14271.1 hypothetical protein OsJ_04197 [Oryza sativa Japonica Group] EAZ30723.1 hypothetical protein OsJ_14783 [Oryza sativa Japonica Group] EAZ35903.1 hypothetical protein OsJ_20204 [Oryza sativa Japonica Group] CAN73758.1 hypothetical protein VITISV_031197 [Vitis vinifera] CAN80002.1 hypothetical protein VITISV_043973 [Vitis vinifera] CAN83843.1 hypothetical protein VITISV_044079 [Vitis vinifera] CAN80880.1 hypothetical protein VITISV_018649 [Vitis vinifera] CAN83194.1 hypothetical protein VITISV_010341 [Vitis vinifera] ABS11143.1 histone H3 [Nicotiana benthamiana] BAF76800.1 histone H3.1 [Nicotiana tabacum] ACF79612.1 unknown [Zea mays] ACF82232.1 unknown [Zea mays] ACF86247.1 unknown [Zea mays] ACF88431.1 unknown [Zea mays] ACG25137.1 histone H3 [Zea mays] ACG27345.1 histone H3 [Zea mays] ACG30057.1 histone H3 [Zea mays] ACG30474.1 histone H3 [Zea mays] ACG30701.1 histone H3 [Zea mays] ACG30707.1 histone H3 [Zea mays] ACG30791.1 histone H3 [Zea mays] ACG30950.1 histone H3 [Zea mays] ACG31934.1 histone H3 [Zea mays] ACG36961.1 histone H3 [Zea mays] ACG39635.1 histone H3 [Zea mays] ACG40073.1 histone H3 [Zea mays] ACG40983.1 histone H3 [Zea mays] ACG47284.1 histone H3 [Zea mays] ACG70966.1 histone H3 [Ziziphus jujuba] BAH00243.1 unnamed protein product [Oryza sativa Japonica Group] EEC80059.1 hypothetical protein OsI_21765 [Oryza sativa Indica Group] EEE51672.1 hypothetical protein OsJ_33018 [Oryza sativa Japonica Group] EEE79733.1 hypothetical protein POPTR_0003s22120g [Populus trichocarpa] EEE84047.1 histone H3 family protein [Populus trichocarpa] EEF28815.1 histone h3, putative [Ricinus communis] EEF28818.1 histone h3, putative [Ricinus communis] EEF28820.1 histone h3, putative [Ricinus communis] EEF28821.1 histone h3, putative [Ricinus communis] EEF37755.1 histone h3, putative [Ricinus communis] EEF39802.1 histone h3, putative [Ricinus communis] ACN33923.1 unknown [Zea mays] ACR37182.1 unknown [Zea mays] ACR37485.1 unknown [Zea mays] ACR37603.1 unknown [Zea mays] ACR37986.1 unknown [Zea mays] ACR38054.1 unknown [Zea mays] EER87889.1 hypothetical protein SORBI_010G047100 [Sorghum bicolor] EER89236.1 hypothetical protein SORBI_010G047200 [Sorghum bicolor] EES05210.1 hypothetical protein SORBI_004G170500 [Sorghum bicolor] EES10786.1 hypothetical protein SORBI_006G076400 [Sorghum bicolor] EES12174.1 hypothetical protein SORBI_006G081800 [Sorghum bicolor] EES19602.1 hypothetical protein SORBI_009G152900 [Sorghum bicolor] BAH93339.1 Os06g0159501 [Oryza sativa Japonica Group] BAH93341.1 Os06g0160001 [Oryza sativa Japonica Group] ADC54261.1 histone H3 [Oryza sativa Japonica Group] ADE76159.1 unknown [Picea sitchensis] ADE76345.1 unknown [Picea sitchensis] ADE76464.1 unknown [Picea sitchensis] ADE77414.1 unknown [Picea sitchensis] EFH49713.1 histone H3 [Arabidopsis lyrata subsp. lyrata] EFH49714.1 histone H3 [Arabidopsis lyrata subsp. lyrata] EFH53304.1 histone H3 [Arabidopsis lyrata subsp. lyrata] EFH68749.1 histone H3 [Arabidopsis lyrata subsp. lyrata] EFH70907.1 histone H3 [Arabidopsis lyrata subsp. lyrata] ADR30794.1 histone H3.1 [Hevea brasiliensis] BAJ53177.1 JHL18I08.11 [Jatropha curcas] AED91535.1 Histone superfamily protein [Arabidopsis thaliana] AED91536.1 Histone superfamily protein [Arabidopsis thaliana] AED98043.1 Histone superfamily protein [Arabidopsis thaliana] AEE28413.1 Histone superfamily protein [Arabidopsis thaliana] AEE77308.1 Histone superfamily protein [Arabidopsis thaliana] CCD74495.1 histone H3 [Arabidopsis halleri subsp. halleri] EOA22021.1 hypothetical protein CARUB_v10002544mg [Capsella rubella] EOA22699.1 hypothetical protein CARUB_v10003405mg [Capsella rubella] EOA25431.1 hypothetical protein CARUB_v10018763mg [Capsella rubella] EOA37535.1 hypothetical protein CARUB_v10011755mg [Capsella rubella] EOX91995.1 Histone superfamily protein [Theobroma cacao] EOY32556.1 Histone superfamily protein [Theobroma cacao] EPS69903.1 hypothetical protein M569_04854 [Genlisea aurea] ERM95023.1 hypothetical protein AMTR_s00009p00240080 [Amborella trichopoda] ERN16002.1 hypothetical protein AMTR_s00030p00044250 [Amborella trichopoda] EEE98723.2 hypothetical protein POPTR_0014s09260g [Populus trichocarpa] ERP63908.1 hypothetical protein POPTR_0003s22240g [Populus trichocarpa] ERP63992.1 hypothetical protein POPTR_0002s03030g [Populus trichocarpa] ESQ31330.1 hypothetical protein EUTSA_v10005111mg [Eutrema salsugineum] ESQ31480.1 hypothetical protein EUTSA_v10005114mg [Eutrema salsugineum] ESQ38364.1 hypothetical protein EUTSA_v10029057mg [Eutrema salsugineum] ESQ40985.1 hypothetical protein EUTSA_v10014986mg [Eutrema salsugineum] ESQ40987.1 hypothetical protein EUTSA_v10014985mg [Eutrema salsugineum] ESR39550.1 hypothetical protein CICLE_v10026742mg [Citrus clementina] ESR59247.1 hypothetical protein CICLE_v10017132mg [Citrus clementina] ESR59252.1 hypothetical protein CICLE_v10017131mg [Citrus clementina] ESR59267.1 hypothetical protein CICLE_v10017133mg [Citrus clementina] EXB28981.1 Histone [Morus notabilis] EXB28982.1 Histone [Morus notabilis] EXB48389.1 Histone [Morus notabilis] EXB48391.1 Histone [Morus notabilis] EXC30548.1 Histone [Morus notabilis] EYU18019.1 hypothetical protein MIMGU_mgv1a016053mg [Erythranthe guttata] EYU18357.1 hypothetical protein MIMGU_mgv1a016039mg [Erythranthe guttata] EYU26936.1 hypothetical protein MIMGU_mgv1a016046mg [Erythranthe guttata] EYU39090.1 hypothetical protein MIMGU_mgv1a016037mg [Erythranthe guttata] EYU43364.1 hypothetical protein MIMGU_mgv1a024982mg [Erythranthe guttata] EYU46298.1 hypothetical protein MIMGU_mgv1a016044mg [Erythranthe guttata] KCW52687.1 hypothetical protein EUGRSUZ_J02055 [Eucalyptus grandis] KCW87138.1 hypothetical protein EUGRSUZ_B03665 [Eucalyptus grandis] KDO60645.1 hypothetical protein CISIN_1g032664mg [Citrus sinensis] KDO64858.1 hypothetical protein CISIN_1g032661mg [Citrus sinensis] KDO64866.1 hypothetical protein CISIN_1g032673mg [Citrus sinensis] KDO64873.1 hypothetical protein CISIN_1g032676mg [Citrus sinensis] KDP20190.1 hypothetical protein JCGZ_07910 [Jatropha curcas] KDP21024.1 hypothetical protein JCGZ_21495 [Jatropha curcas] CDP11387.1 unnamed protein product [Coffea canephora] CDP07721.1 unnamed protein product [Coffea canephora] CDP07722.1 unnamed protein product [Coffea canephora] KFK25331.1 hypothetical protein AALP_AA8G099000 [Arabis alpina] KFK25332.1 hypothetical protein AALP_AA8G099100 [Arabis alpina] KFK28215.1 hypothetical protein AALP_AA8G487700 [Arabis alpina] KFK28217.1 hypothetical protein AALP_AA8G487900 [Arabis alpina] KFK43216.1 hypothetical protein AALP_AA1G095700 [Arabis alpina] CDX96998.1 BnaC09g46270D [Brassica napus] CDX69839.1 BnaA10g21880D [Brassica napus] KGN54155.1 histone H3 [Cucumis sativus] AIZ04726.1 histone 3 [Elettaria cardamomum] KJB21399.1 hypothetical protein B456_004G040400 [Gossypium raimondii] KJB21400.1 hypothetical protein B456_004G040400 [Gossypium raimondii] KJB27088.1 hypothetical protein B456_004G277200 [Gossypium raimondii] KJB54045.1 hypothetical protein B456_009G018200 [Gossypium raimondii] KJB70057.1 hypothetical protein B456_011G056400 [Gossypium raimondii] KJB70058.1 hypothetical protein B456_011G056400 [Gossypium raimondii] KJB70059.1 hypothetical protein B456_011G056500 [Gossypium raimondii] KJB83503.1 hypothetical protein B456_013G250500 [Gossypium raimondii] KMT13094.1 hypothetical protein BVRB_4g086350 [Beta vulgaris subsp. vulgaris] KMT13099.1 hypothetical protein BVRB_4g086410 [Beta vulgaris subsp. vulgaris] KMT13100.1 hypothetical protein BVRB_4g086420 [Beta vulgaris subsp. vulgaris] KMT14440.1 hypothetical protein BVRB_4g072160 [Beta vulgaris subsp. vulgaris] KMT14442.1 hypothetical protein BVRB_4g072180 [Beta vulgaris subsp. vulgaris] KNA08063.1 hypothetical protein SOVF_166110 [Spinacia oleracea] KNA10491.1 hypothetical protein SOVF_143550 [Spinacia oleracea] KNA19691.1 hypothetical protein SOVF_059220 [Spinacia oleracea] KNA24957.1 hypothetical protein SOVF_010940 [Spinacia oleracea] KNA25425.1 hypothetical protein SOVF_005400 [Spinacia oleracea] KNA26076.1 hypothetical protein SOVF_000590 [Spinacia oleracea] BAS96275.1 Os06g0160001 [Oryza sativa Japonica Group] BAT12754.1 Os11g0155900 [Oryza sativa Japonica Group] KQL09665.1 hypothetical protein SETIT_007481mg [Setaria italica] KQL09668.1 hypothetical protein SETIT_008119mg [Setaria italica] KQL15301.1 hypothetical protein SETIT_023606mg [Setaria italica] ALY11031.1 histone h3 [Ziziphus jujuba] KVH91569.1 Histone core [Cynara cardunculus var. scolymus] KVI09448.1 Histone core [Cynara cardunculus var. scolymus] KZN09387.1 hypothetical protein DCAR_002043 [Daucus carota subsp. sativus] KZV18472.1 hypothetical protein F511_18040 [Dorcoceras hygrometricum] KZV44364.1 hypothetical protein F511_26446 [Dorcoceras hygrometricum] KZV49603.1 hypothetical protein F511_23983 [Dorcoceras hygrometricum] KZV57557.1 hypothetical protein F511_03017 [Dorcoceras hygrometricum] OAO92781.1 hypothetical protein AXX17_AT5G10060 [Arabidopsis thaliana] OAO93749.1 hypothetical protein AXX17_AT5G65170 [Arabidopsis thaliana] OAO95383.1 hypothetical protein AXX17_AT5G10050 [Arabidopsis thaliana] OAP05420.1 hypothetical protein AXX17_AT3G29860 [Arabidopsis thaliana] OAP16403.1 hypothetical protein AXX17_AT1G09060 [Arabidopsis thaliana] OAY22690.1 hypothetical protein MANES_18G018500 [Manihot esculenta] OAY22691.1 hypothetical protein MANES_18G018600 [Manihot esculenta] OAY26256.1 hypothetical protein MANES_16G033300 [Manihot esculenta] OAY26257.1 hypothetical protein MANES_16G033400 [Manihot esculenta] OAY30213.1 hypothetical protein MANES_14G013600 [Manihot esculenta] OAY33453.1 hypothetical protein MANES_13G097500 [Manihot esculenta] OAY33454.1 hypothetical protein MANES_13G097600 [Manihot esculenta] OAY35771.1 hypothetical protein MANES_12G129100 [Manihot esculenta] OAY48573.1 hypothetical protein MANES_06G168000 [Manihot esculenta] OAY76534.1 histone H3.2 [Ananas comosus] OAY84850.1 histone H3.2 [Ananas comosus] JAT57653.1 Histone H3.2 [Anthurium amnicola] JAT59910.1 Histone H3.2 [Anthurium amnicola] OEL28075.1 histone H3.2 [Dichanthelium oligosanthes] OEL37560.1 histone H3.2 [Dichanthelium oligosanthes] JAU09216.1 Histone H3.2 [Noccaea caerulescens] JAU41716.1 Histone H3.2 [Noccaea caerulescens] JAU57789.1 Histone H3.2 [Noccaea caerulescens] JAU93725.1 Histone H3.2 [Noccaea caerulescens] OIT01611.1 histone h3.2 [Nicotiana attenuata] OIT06005.1 histone h3.2 [Nicotiana attenuata] OIT19610.1 histone h3.2 [Nicotiana attenuata] OIT29440.1 histone h3.2 [Nicotiana attenuata] OIT33820.1 histone h3.2 [Nicotiana attenuata] OIT33823.1 histone h3.2 [Nicotiana attenuata] OIT34440.1 histone h3.2 [Nicotiana attenuata] OIT35721.1 histone h3.2 [Nicotiana attenuata] OMO56171.1 histone H3 [Corchorus capsularis] OMO61394.1 histone H3 [Corchorus capsularis] OMO68602.1 histone H3 [Corchorus capsularis] OMO73020.1 histone H3 [Corchorus olitorius] OMO75026.1 histone H3 [Corchorus olitorius] OMO78124.1 histone H3 [Corchorus olitorius] OMO79345.1 histone H3 [Corchorus capsularis] OMP07230.1 histone H3 [Corchorus olitorius] ONH99186.1 hypothetical protein PRUPE_6G016200 [Prunus persica] ONH99252.1 hypothetical protein PRUPE_6G021100 [Prunus persica] ONH99260.1 hypothetical protein PRUPE_6G021700 [Prunus persica] ONI10569.1 hypothetical protein PRUPE_4G054300 [Prunus persica] AQK43642.1 Histone H3.2 [Zea mays] AQK43643.1 Histone H3.2 [Zea mays] AQK43644.1 Histone H3.2 [Zea mays] AQK43690.1 Histone H3.2 [Zea mays] ONM17576.1 Histone H3.2 [Zea mays] ONM17641.1 Histone H3.2 [Zea mays] ONM29953.1 Histone H3.2 [Zea mays] ONM33459.1 Histone H3.2 [Zea mays] AQK52929.1 Histone H3.2 [Zea mays] AQK80506.1 Histone H3-like 5 [Zea mays] AQL01931.1 Histone H3.2 [Zea mays] prf||1303352A histone H3 prf||1314298B histone H3 Length = 136 Score = 262 bits (670), Expect = 4e-88 Identities = 135/136 (99%), Positives = 136/136 (100%) Frame = +1 Query: 82 MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVALREIRKYQKSTE 261 MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVALREIRKYQKSTE Sbjct: 1 MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVALREIRKYQKSTE 60 Query: 262 LLIRKLPFQRLVREIAQDFKTDLRFQSSAVSALQEAAEAYLVGLFEDTNLCAIHAKRVTI 441 LLIRKLPFQRLVREIAQDFKTDLRFQSSAV+ALQEAAEAYLVGLFEDTNLCAIHAKRVTI Sbjct: 61 LLIRKLPFQRLVREIAQDFKTDLRFQSSAVAALQEAAEAYLVGLFEDTNLCAIHAKRVTI 120 Query: 442 MPKDIQLARRIRGERA 489 MPKDIQLARRIRGERA Sbjct: 121 MPKDIQLARRIRGERA 136 >CBH32561.1 histone H3, expressed [Triticum aestivum] BAJ89751.1 predicted protein [Hordeum vulgare subsp. vulgare] BAK01873.1 predicted protein [Hordeum vulgare subsp. vulgare] BAK06522.1 predicted protein [Hordeum vulgare subsp. vulgare] BAJ88326.1 predicted protein [Hordeum vulgare subsp. vulgare] BAK07409.1 predicted protein [Hordeum vulgare subsp. vulgare] BAK04782.1 predicted protein [Hordeum vulgare subsp. vulgare] BAK05326.1 predicted protein [Hordeum vulgare subsp. vulgare] CDM85134.1 unnamed protein product [Triticum aestivum] Length = 136 Score = 262 bits (670), Expect = 4e-88 Identities = 135/136 (99%), Positives = 136/136 (100%) Frame = +1 Query: 82 MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVALREIRKYQKSTE 261 MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVALREIRKYQKSTE Sbjct: 1 MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVALREIRKYQKSTE 60 Query: 262 LLIRKLPFQRLVREIAQDFKTDLRFQSSAVSALQEAAEAYLVGLFEDTNLCAIHAKRVTI 441 LLIRKLPFQRLVREIAQDFKTDLRFQSSAVSALQEAAE+YLVGLFEDTNLCAIHAKRVTI Sbjct: 61 LLIRKLPFQRLVREIAQDFKTDLRFQSSAVSALQEAAESYLVGLFEDTNLCAIHAKRVTI 120 Query: 442 MPKDIQLARRIRGERA 489 MPKDIQLARRIRGERA Sbjct: 121 MPKDIQLARRIRGERA 136 >JAU22951.1 Histone H3.2, partial [Noccaea caerulescens] Length = 157 Score = 263 bits (672), Expect = 4e-88 Identities = 135/137 (98%), Positives = 137/137 (100%) Frame = +1 Query: 79 RMARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVALREIRKYQKST 258 +MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVALREIRKYQKST Sbjct: 21 KMARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVALREIRKYQKST 80 Query: 259 ELLIRKLPFQRLVREIAQDFKTDLRFQSSAVSALQEAAEAYLVGLFEDTNLCAIHAKRVT 438 ELLIRKLPFQRLVREIAQDFKTDLRFQSSAV+ALQEAAEAYLVGLFEDTNLCAIHAKRVT Sbjct: 81 ELLIRKLPFQRLVREIAQDFKTDLRFQSSAVAALQEAAEAYLVGLFEDTNLCAIHAKRVT 140 Query: 439 IMPKDIQLARRIRGERA 489 IMPKDIQLARRIRGERA Sbjct: 141 IMPKDIQLARRIRGERA 157 >XP_006301260.1 hypothetical protein CARUB_v10021660mg, partial [Capsella rubella] EOA34158.1 hypothetical protein CARUB_v10021660mg, partial [Capsella rubella] Length = 169 Score = 263 bits (673), Expect = 4e-88 Identities = 138/149 (92%), Positives = 142/149 (95%), Gaps = 1/149 (0%) Frame = +1 Query: 46 YPCFRSVRV*ER-MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTV 222 + F S R+ + MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTV Sbjct: 21 FKTFSSFRIYSKEMARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTV 80 Query: 223 ALREIRKYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVSALQEAAEAYLVGLFED 402 ALREIRKYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAV+ALQEAAEAYLVGLFED Sbjct: 81 ALREIRKYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVAALQEAAEAYLVGLFED 140 Query: 403 TNLCAIHAKRVTIMPKDIQLARRIRGERA 489 TNLCAIHAKRVTIMPKDIQLARRIRGERA Sbjct: 141 TNLCAIHAKRVTIMPKDIQLARRIRGERA 169 >JAU86177.1 Histone H3.2, partial [Noccaea caerulescens] Length = 163 Score = 263 bits (672), Expect = 4e-88 Identities = 135/137 (98%), Positives = 137/137 (100%) Frame = +1 Query: 79 RMARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVALREIRKYQKST 258 +MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVALREIRKYQKST Sbjct: 27 KMARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVALREIRKYQKST 86 Query: 259 ELLIRKLPFQRLVREIAQDFKTDLRFQSSAVSALQEAAEAYLVGLFEDTNLCAIHAKRVT 438 ELLIRKLPFQRLVREIAQDFKTDLRFQSSAV+ALQEAAEAYLVGLFEDTNLCAIHAKRVT Sbjct: 87 ELLIRKLPFQRLVREIAQDFKTDLRFQSSAVAALQEAAEAYLVGLFEDTNLCAIHAKRVT 146 Query: 439 IMPKDIQLARRIRGERA 489 IMPKDIQLARRIRGERA Sbjct: 147 IMPKDIQLARRIRGERA 163 >JAU40640.1 Histone H3.2, partial [Noccaea caerulescens] Length = 163 Score = 263 bits (672), Expect = 4e-88 Identities = 135/137 (98%), Positives = 137/137 (100%) Frame = +1 Query: 79 RMARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVALREIRKYQKST 258 +MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVALREIRKYQKST Sbjct: 27 KMARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVALREIRKYQKST 86 Query: 259 ELLIRKLPFQRLVREIAQDFKTDLRFQSSAVSALQEAAEAYLVGLFEDTNLCAIHAKRVT 438 ELLIRKLPFQRLVREIAQDFKTDLRFQSSAV+ALQEAAEAYLVGLFEDTNLCAIHAKRVT Sbjct: 87 ELLIRKLPFQRLVREIAQDFKTDLRFQSSAVAALQEAAEAYLVGLFEDTNLCAIHAKRVT 146 Query: 439 IMPKDIQLARRIRGERA 489 IMPKDIQLARRIRGERA Sbjct: 147 IMPKDIQLARRIRGERA 163 >XP_017621393.1 PREDICTED: histone H3.2-like [Gossypium arboreum] Length = 136 Score = 262 bits (669), Expect = 5e-88 Identities = 134/136 (98%), Positives = 136/136 (100%) Frame = +1 Query: 82 MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVALREIRKYQKSTE 261 MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVALREIRKYQKSTE Sbjct: 1 MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVALREIRKYQKSTE 60 Query: 262 LLIRKLPFQRLVREIAQDFKTDLRFQSSAVSALQEAAEAYLVGLFEDTNLCAIHAKRVTI 441 LLIRKLPFQRLVREIAQDFKTDLRFQSSAV+ALQEAAEAYLVGLFEDTNLCAIHAKRVTI Sbjct: 61 LLIRKLPFQRLVREIAQDFKTDLRFQSSAVAALQEAAEAYLVGLFEDTNLCAIHAKRVTI 120 Query: 442 MPKDIQLARRIRGERA 489 MPKD+QLARRIRGERA Sbjct: 121 MPKDVQLARRIRGERA 136 >AAA32655.1 histone H3 (H3-1.1) [Medicago sativa] Length = 136 Score = 262 bits (669), Expect = 5e-88 Identities = 135/136 (99%), Positives = 135/136 (99%) Frame = +1 Query: 82 MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVALREIRKYQKSTE 261 MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVALREIRKYQKSTE Sbjct: 1 MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVALREIRKYQKSTE 60 Query: 262 LLIRKLPFQRLVREIAQDFKTDLRFQSSAVSALQEAAEAYLVGLFEDTNLCAIHAKRVTI 441 LLIRKLPFQRLVREIAQDFKTDLRFQSS VSALQEAAEAYLVGLFEDTNLCAIHAKRVTI Sbjct: 61 LLIRKLPFQRLVREIAQDFKTDLRFQSSVVSALQEAAEAYLVGLFEDTNLCAIHAKRVTI 120 Query: 442 MPKDIQLARRIRGERA 489 MPKDIQLARRIRGERA Sbjct: 121 MPKDIQLARRIRGERA 136 >XP_010260926.1 PREDICTED: histone H3.2-like [Nelumbo nucifera] Length = 136 Score = 262 bits (669), Expect = 5e-88 Identities = 135/136 (99%), Positives = 135/136 (99%) Frame = +1 Query: 82 MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVALREIRKYQKSTE 261 MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVALREIRKYQKSTE Sbjct: 1 MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVALREIRKYQKSTE 60 Query: 262 LLIRKLPFQRLVREIAQDFKTDLRFQSSAVSALQEAAEAYLVGLFEDTNLCAIHAKRVTI 441 LIRKLPFQRLVREIAQDFKTDLRFQSSAVSALQEAAEAYLVGLFEDTNLCAIHAKRVTI Sbjct: 61 FLIRKLPFQRLVREIAQDFKTDLRFQSSAVSALQEAAEAYLVGLFEDTNLCAIHAKRVTI 120 Query: 442 MPKDIQLARRIRGERA 489 MPKDIQLARRIRGERA Sbjct: 121 MPKDIQLARRIRGERA 136 >CDP18134.1 unnamed protein product [Coffea canephora] Length = 136 Score = 262 bits (669), Expect = 5e-88 Identities = 134/136 (98%), Positives = 136/136 (100%) Frame = +1 Query: 82 MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVALREIRKYQKSTE 261 MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVALREIRKYQKSTE Sbjct: 1 MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVALREIRKYQKSTE 60 Query: 262 LLIRKLPFQRLVREIAQDFKTDLRFQSSAVSALQEAAEAYLVGLFEDTNLCAIHAKRVTI 441 LLIRKLPFQRLVREIAQDFKTDLRFQSSAV+ALQEAAEAYLVGLFEDTNLCAIHAKRVT+ Sbjct: 61 LLIRKLPFQRLVREIAQDFKTDLRFQSSAVAALQEAAEAYLVGLFEDTNLCAIHAKRVTV 120 Query: 442 MPKDIQLARRIRGERA 489 MPKDIQLARRIRGERA Sbjct: 121 MPKDIQLARRIRGERA 136 >EOY31042.1 Histone superfamily protein [Theobroma cacao] Length = 220 Score = 265 bits (677), Expect = 5e-88 Identities = 140/156 (89%), Positives = 145/156 (92%) Frame = +1 Query: 22 LLQISN*RYPCFRSVRV*ERMARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPH 201 LL +S ++ C S + MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPH Sbjct: 67 LLTVSQTKHSCLLSTFL--PMARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPH 124 Query: 202 RFRPGTVALREIRKYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVSALQEAAEAY 381 RFRPGTVALREIRKYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAV+ALQEAAEAY Sbjct: 125 RFRPGTVALREIRKYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVAALQEAAEAY 184 Query: 382 LVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA 489 LVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA Sbjct: 185 LVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA 220