BLASTX nr result
ID: Glycyrrhiza36_contig00028757
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza36_contig00028757 (367 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_013443399.1 hypothetical protein MTR_0016s0170 [Medicago trun... 64 4e-11 >XP_013443399.1 hypothetical protein MTR_0016s0170 [Medicago truncatula] KEH17424.1 hypothetical protein MTR_0016s0170 [Medicago truncatula] Length = 81 Score = 63.9 bits (154), Expect = 4e-11 Identities = 29/41 (70%), Positives = 32/41 (78%) Frame = +2 Query: 242 GPEGGTDPLGKKLKTRLWY*KPCWFCFPWRITLLSYVFSLM 364 GPEGGTDPLGKKLKT+L Y KPCW CFP R LLS F ++ Sbjct: 8 GPEGGTDPLGKKLKTKLLYGKPCWPCFPCRNLLLSSSFKVV 48