BLASTX nr result
ID: Glycyrrhiza36_contig00028582
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza36_contig00028582 (536 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_017442864.1 PREDICTED: E3 ubiquitin protein ligase DRIP2-like... 62 3e-08 XP_014495230.1 PREDICTED: E3 ubiquitin protein ligase DRIP2-like... 62 3e-08 BAT85498.1 hypothetical protein VIGAN_04305400 [Vigna angularis ... 62 3e-08 KOM25150.1 hypothetical protein LR48_Vigan50s007000 [Vigna angul... 62 3e-08 XP_007162503.1 hypothetical protein PHAVU_001G157400g [Phaseolus... 62 4e-08 XP_016204715.1 PREDICTED: E3 ubiquitin protein ligase DRIP2-like... 61 8e-08 KYP54797.1 Polycomb group RING finger protein 1 [Cajanus cajan] 61 1e-07 XP_015969707.1 PREDICTED: E3 ubiquitin protein ligase DRIP2-like... 59 5e-07 XP_012569352.1 PREDICTED: E3 ubiquitin protein ligase DRIP2-like... 57 3e-06 XP_012569351.1 PREDICTED: E3 ubiquitin protein ligase DRIP2-like... 57 3e-06 KRH67310.1 hypothetical protein GLYMA_03G159500 [Glycine max] 56 4e-06 KRH67311.1 hypothetical protein GLYMA_03G159500 [Glycine max] 56 4e-06 XP_003520583.1 PREDICTED: E3 ubiquitin protein ligase DRIP2-like... 56 4e-06 XP_003553481.1 PREDICTED: E3 ubiquitin protein ligase DRIP2-like... 56 5e-06 KHN02532.1 E3 ubiquitin protein ligase DRIP2 [Glycine soja] 56 5e-06 OAY61589.1 hypothetical protein MANES_01G201200 [Manihot esculenta] 56 5e-06 GAU33248.1 hypothetical protein TSUD_333710 [Trifolium subterran... 55 7e-06 XP_013449837.1 E3 ubiquitin protein ligase DRIP2, putative [Medi... 55 7e-06 XP_013449836.1 E3 ubiquitin protein ligase DRIP2, putative [Medi... 55 7e-06 XP_016741533.1 PREDICTED: E3 ubiquitin protein ligase DRIP2-like... 55 7e-06 >XP_017442864.1 PREDICTED: E3 ubiquitin protein ligase DRIP2-like [Vigna angularis] Length = 429 Score = 62.4 bits (150), Expect = 3e-08 Identities = 30/31 (96%), Positives = 30/31 (96%) Frame = -2 Query: 535 ASTSQRIPATIGSSAKDFVMVLAYARKAPHP 443 ASTSQRIPATIGSSAKDFVMVLAYARK PHP Sbjct: 399 ASTSQRIPATIGSSAKDFVMVLAYARKVPHP 429 >XP_014495230.1 PREDICTED: E3 ubiquitin protein ligase DRIP2-like [Vigna radiata var. radiata] Length = 429 Score = 62.4 bits (150), Expect = 3e-08 Identities = 30/31 (96%), Positives = 30/31 (96%) Frame = -2 Query: 535 ASTSQRIPATIGSSAKDFVMVLAYARKAPHP 443 ASTSQRIPATIGSSAKDFVMVLAYARK PHP Sbjct: 399 ASTSQRIPATIGSSAKDFVMVLAYARKVPHP 429 >BAT85498.1 hypothetical protein VIGAN_04305400 [Vigna angularis var. angularis] Length = 430 Score = 62.4 bits (150), Expect = 3e-08 Identities = 30/31 (96%), Positives = 30/31 (96%) Frame = -2 Query: 535 ASTSQRIPATIGSSAKDFVMVLAYARKAPHP 443 ASTSQRIPATIGSSAKDFVMVLAYARK PHP Sbjct: 400 ASTSQRIPATIGSSAKDFVMVLAYARKVPHP 430 >KOM25150.1 hypothetical protein LR48_Vigan50s007000 [Vigna angularis] Length = 479 Score = 62.4 bits (150), Expect = 3e-08 Identities = 30/31 (96%), Positives = 30/31 (96%) Frame = -2 Query: 535 ASTSQRIPATIGSSAKDFVMVLAYARKAPHP 443 ASTSQRIPATIGSSAKDFVMVLAYARK PHP Sbjct: 449 ASTSQRIPATIGSSAKDFVMVLAYARKVPHP 479 >XP_007162503.1 hypothetical protein PHAVU_001G157400g [Phaseolus vulgaris] ESW34497.1 hypothetical protein PHAVU_001G157400g [Phaseolus vulgaris] Length = 429 Score = 62.0 bits (149), Expect = 4e-08 Identities = 30/31 (96%), Positives = 30/31 (96%) Frame = -2 Query: 535 ASTSQRIPATIGSSAKDFVMVLAYARKAPHP 443 ASTSQRIPATIGSSAKDFVMVLAYARK PHP Sbjct: 399 ASTSQRIPATIGSSAKDFVMVLAYARKPPHP 429 >XP_016204715.1 PREDICTED: E3 ubiquitin protein ligase DRIP2-like [Arachis ipaensis] XP_016204716.1 PREDICTED: E3 ubiquitin protein ligase DRIP2-like [Arachis ipaensis] XP_016204717.1 PREDICTED: E3 ubiquitin protein ligase DRIP2-like [Arachis ipaensis] Length = 430 Score = 61.2 bits (147), Expect = 8e-08 Identities = 29/31 (93%), Positives = 30/31 (96%) Frame = -2 Query: 535 ASTSQRIPATIGSSAKDFVMVLAYARKAPHP 443 A+TSQRIPATIGSSAKDFVMVLAYARK PHP Sbjct: 400 AATSQRIPATIGSSAKDFVMVLAYARKVPHP 430 >KYP54797.1 Polycomb group RING finger protein 1 [Cajanus cajan] Length = 446 Score = 60.8 bits (146), Expect = 1e-07 Identities = 29/31 (93%), Positives = 30/31 (96%) Frame = -2 Query: 535 ASTSQRIPATIGSSAKDFVMVLAYARKAPHP 443 ASTSQRIPATIGSSAK+FVMVLAYARK PHP Sbjct: 416 ASTSQRIPATIGSSAKEFVMVLAYARKVPHP 446 >XP_015969707.1 PREDICTED: E3 ubiquitin protein ligase DRIP2-like [Arachis duranensis] XP_015969708.1 PREDICTED: E3 ubiquitin protein ligase DRIP2-like [Arachis duranensis] Length = 430 Score = 58.9 bits (141), Expect = 5e-07 Identities = 28/31 (90%), Positives = 30/31 (96%) Frame = -2 Query: 535 ASTSQRIPATIGSSAKDFVMVLAYARKAPHP 443 A+TSQRIPATIGSSAKDFVMVLAYARK P+P Sbjct: 400 AATSQRIPATIGSSAKDFVMVLAYARKVPYP 430 >XP_012569352.1 PREDICTED: E3 ubiquitin protein ligase DRIP2-like isoform X2 [Cicer arietinum] Length = 426 Score = 56.6 bits (135), Expect = 3e-06 Identities = 27/30 (90%), Positives = 27/30 (90%) Frame = -2 Query: 532 STSQRIPATIGSSAKDFVMVLAYARKAPHP 443 STS RIPA IGSSAKDFVMVLAYARK PHP Sbjct: 397 STSHRIPAIIGSSAKDFVMVLAYARKTPHP 426 >XP_012569351.1 PREDICTED: E3 ubiquitin protein ligase DRIP2-like isoform X1 [Cicer arietinum] Length = 427 Score = 56.6 bits (135), Expect = 3e-06 Identities = 27/30 (90%), Positives = 27/30 (90%) Frame = -2 Query: 532 STSQRIPATIGSSAKDFVMVLAYARKAPHP 443 STS RIPA IGSSAKDFVMVLAYARK PHP Sbjct: 398 STSHRIPAIIGSSAKDFVMVLAYARKTPHP 427 >KRH67310.1 hypothetical protein GLYMA_03G159500 [Glycine max] Length = 392 Score = 56.2 bits (134), Expect = 4e-06 Identities = 27/30 (90%), Positives = 27/30 (90%) Frame = -2 Query: 535 ASTSQRIPATIGSSAKDFVMVLAYARKAPH 446 AST QRIPATIGSSAKDFVMVLAY RK PH Sbjct: 362 ASTPQRIPATIGSSAKDFVMVLAYGRKVPH 391 >KRH67311.1 hypothetical protein GLYMA_03G159500 [Glycine max] Length = 416 Score = 56.2 bits (134), Expect = 4e-06 Identities = 27/30 (90%), Positives = 27/30 (90%) Frame = -2 Query: 535 ASTSQRIPATIGSSAKDFVMVLAYARKAPH 446 AST QRIPATIGSSAKDFVMVLAY RK PH Sbjct: 386 ASTPQRIPATIGSSAKDFVMVLAYGRKVPH 415 >XP_003520583.1 PREDICTED: E3 ubiquitin protein ligase DRIP2-like [Glycine max] KHN10712.1 E3 ubiquitin protein ligase DRIP2 [Glycine soja] KRH67309.1 hypothetical protein GLYMA_03G159500 [Glycine max] Length = 445 Score = 56.2 bits (134), Expect = 4e-06 Identities = 27/30 (90%), Positives = 27/30 (90%) Frame = -2 Query: 535 ASTSQRIPATIGSSAKDFVMVLAYARKAPH 446 AST QRIPATIGSSAKDFVMVLAY RK PH Sbjct: 415 ASTPQRIPATIGSSAKDFVMVLAYGRKVPH 444 >XP_003553481.1 PREDICTED: E3 ubiquitin protein ligase DRIP2-like [Glycine max] KRG95629.1 hypothetical protein GLYMA_19G161700 [Glycine max] Length = 428 Score = 55.8 bits (133), Expect = 5e-06 Identities = 27/31 (87%), Positives = 28/31 (90%) Frame = -2 Query: 535 ASTSQRIPATIGSSAKDFVMVLAYARKAPHP 443 A TSQRIPATIGSSAKDFVMVLAYAR+ P P Sbjct: 398 APTSQRIPATIGSSAKDFVMVLAYARRVPDP 428 >KHN02532.1 E3 ubiquitin protein ligase DRIP2 [Glycine soja] Length = 429 Score = 55.8 bits (133), Expect = 5e-06 Identities = 27/31 (87%), Positives = 28/31 (90%) Frame = -2 Query: 535 ASTSQRIPATIGSSAKDFVMVLAYARKAPHP 443 A TSQRIPATIGSSAKDFVMVLAYAR+ P P Sbjct: 399 APTSQRIPATIGSSAKDFVMVLAYARRVPDP 429 >OAY61589.1 hypothetical protein MANES_01G201200 [Manihot esculenta] Length = 431 Score = 55.8 bits (133), Expect = 5e-06 Identities = 26/31 (83%), Positives = 29/31 (93%) Frame = -2 Query: 535 ASTSQRIPATIGSSAKDFVMVLAYARKAPHP 443 ASTS+R+PA+IGSSAKDFVMVLAYARK P P Sbjct: 400 ASTSERVPASIGSSAKDFVMVLAYARKVPDP 430 >GAU33248.1 hypothetical protein TSUD_333710 [Trifolium subterraneum] Length = 361 Score = 55.5 bits (132), Expect = 7e-06 Identities = 26/31 (83%), Positives = 28/31 (90%) Frame = -2 Query: 535 ASTSQRIPATIGSSAKDFVMVLAYARKAPHP 443 +S S RIPA IGSSAKDFVMVLAY+RKAPHP Sbjct: 331 SSASDRIPAIIGSSAKDFVMVLAYSRKAPHP 361 >XP_013449837.1 E3 ubiquitin protein ligase DRIP2, putative [Medicago truncatula] KEH23865.1 E3 ubiquitin protein ligase DRIP2, putative [Medicago truncatula] Length = 428 Score = 55.5 bits (132), Expect = 7e-06 Identities = 27/31 (87%), Positives = 28/31 (90%) Frame = -2 Query: 535 ASTSQRIPATIGSSAKDFVMVLAYARKAPHP 443 ASTS RIPA IGSSAKDFVMVLAYARK+P P Sbjct: 398 ASTSHRIPAIIGSSAKDFVMVLAYARKSPRP 428 >XP_013449836.1 E3 ubiquitin protein ligase DRIP2, putative [Medicago truncatula] KEH23864.1 E3 ubiquitin protein ligase DRIP2, putative [Medicago truncatula] Length = 429 Score = 55.5 bits (132), Expect = 7e-06 Identities = 27/31 (87%), Positives = 28/31 (90%) Frame = -2 Query: 535 ASTSQRIPATIGSSAKDFVMVLAYARKAPHP 443 ASTS RIPA IGSSAKDFVMVLAYARK+P P Sbjct: 399 ASTSHRIPAIIGSSAKDFVMVLAYARKSPRP 429 >XP_016741533.1 PREDICTED: E3 ubiquitin protein ligase DRIP2-like isoform X1 [Gossypium hirsutum] XP_017626818.1 PREDICTED: E3 ubiquitin protein ligase DRIP2-like isoform X1 [Gossypium arboreum] XP_017626819.1 PREDICTED: E3 ubiquitin protein ligase DRIP2-like isoform X2 [Gossypium arboreum] Length = 431 Score = 55.5 bits (132), Expect = 7e-06 Identities = 25/29 (86%), Positives = 29/29 (100%) Frame = -2 Query: 535 ASTSQRIPATIGSSAKDFVMVLAYARKAP 449 ASTSQR+PA++GSSAKDF+MVLAYARKAP Sbjct: 401 ASTSQRVPASVGSSAKDFIMVLAYARKAP 429