BLASTX nr result
ID: Glycyrrhiza36_contig00027448
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza36_contig00027448 (359 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AEQ19302.1 putative translational transactivator, partial [Blueb... 58 4e-08 ADX60608.1 transcriptional activator, partial [Blueberry red rin... 56 2e-07 CUX76634.1 translational transactivator, partial [Blueberry red ... 56 2e-07 ADX60612.1 transcriptional activator, partial [Blueberry red rin... 56 2e-07 ADX60606.1 transcriptional activator, partial [Blueberry red rin... 56 2e-07 AEQ19301.1 putative translational transactivator, partial [Blueb... 56 2e-07 AEQ19299.1 putative translational transactivator, partial [Blueb... 56 2e-07 ADX60614.1 transcriptional activator, partial [Blueberry red rin... 56 2e-07 AEH95574.1 translational transactivator [Blueberry red ringspot ... 56 8e-07 AEQ49590.1 transciptional activator [Blueberry red ringspot virus] 56 1e-06 AEE01493.1 translational transactivator [Blueberry red ringspot ... 56 1e-06 ADX60611.2 transcriptional activator [Blueberry red ringspot virus] 56 1e-06 ADX60607.2 transcriptional activator [Blueberry red ringspot virus] 56 1e-06 ADX60605.2 transcriptional activator [Blueberry red ringspot virus] 56 1e-06 NP_395470.1 putative translational transactivator [Blueberry red... 56 1e-06 ADX60613.1 transcriptional activator, partial [Blueberry red rin... 54 1e-06 ADX60609.1 transcriptional activator, partial [Blueberry red rin... 54 2e-06 NP_042514.1 hypothetical protein [Peanut chlorotic streak virus]... 54 5e-06 >AEQ19302.1 putative translational transactivator, partial [Blueberry red ringspot virus] Length = 167 Score = 58.2 bits (139), Expect = 4e-08 Identities = 24/39 (61%), Positives = 28/39 (71%) Frame = -3 Query: 324 EENKKWYVIFNGPFPGIYDDWYKAAPHCTKIPGIIHKSY 208 + K++YVIFNGP GIYD+WYKAAPH IIHK Y Sbjct: 17 KSKKEYYVIFNGPMKGIYDEWYKAAPHIQGQSSIIHKKY 55 >ADX60608.1 transcriptional activator, partial [Blueberry red ringspot virus] Length = 155 Score = 56.2 bits (134), Expect = 2e-07 Identities = 23/39 (58%), Positives = 28/39 (71%) Frame = -3 Query: 324 EENKKWYVIFNGPFPGIYDDWYKAAPHCTKIPGIIHKSY 208 + K++YVIFNGP GIYD+W+KAAPH IIHK Y Sbjct: 11 KSKKEYYVIFNGPMKGIYDEWHKAAPHIQGQANIIHKKY 49 >CUX76634.1 translational transactivator, partial [Blueberry red ringspot virus] Length = 158 Score = 56.2 bits (134), Expect = 2e-07 Identities = 23/39 (58%), Positives = 28/39 (71%) Frame = -3 Query: 324 EENKKWYVIFNGPFPGIYDDWYKAAPHCTKIPGIIHKSY 208 + K++YVIFNGP GIYD+W+KAAPH IIHK Y Sbjct: 4 KSKKEYYVIFNGPMKGIYDEWHKAAPHIQGQSSIIHKKY 42 >ADX60612.1 transcriptional activator, partial [Blueberry red ringspot virus] Length = 140 Score = 55.8 bits (133), Expect = 2e-07 Identities = 23/36 (63%), Positives = 27/36 (75%) Frame = -3 Query: 315 KKWYVIFNGPFPGIYDDWYKAAPHCTKIPGIIHKSY 208 K++YVIFNGP GIYD+W+KAAPH IIHK Y Sbjct: 9 KEYYVIFNGPMKGIYDEWHKAAPHIQGQSNIIHKKY 44 >ADX60606.1 transcriptional activator, partial [Blueberry red ringspot virus] Length = 143 Score = 55.8 bits (133), Expect = 2e-07 Identities = 23/36 (63%), Positives = 27/36 (75%) Frame = -3 Query: 315 KKWYVIFNGPFPGIYDDWYKAAPHCTKIPGIIHKSY 208 K++YVIFNGP GIYD+W+KAAPH IIHK Y Sbjct: 12 KEYYVIFNGPMKGIYDEWHKAAPHIQGQSNIIHKKY 47 >AEQ19301.1 putative translational transactivator, partial [Blueberry red ringspot virus] AEQ19303.1 putative translational transactivator, partial [Blueberry red ringspot virus] Length = 167 Score = 56.2 bits (134), Expect = 2e-07 Identities = 23/39 (58%), Positives = 28/39 (71%) Frame = -3 Query: 324 EENKKWYVIFNGPFPGIYDDWYKAAPHCTKIPGIIHKSY 208 + K++YVIFNGP GIYD+W+KAAPH IIHK Y Sbjct: 17 KSKKEYYVIFNGPMKGIYDEWHKAAPHIQGQSSIIHKKY 55 >AEQ19299.1 putative translational transactivator, partial [Blueberry red ringspot virus] AEQ19300.1 putative translational transactivator, partial [Blueberry red ringspot virus] Length = 167 Score = 56.2 bits (134), Expect = 2e-07 Identities = 23/39 (58%), Positives = 28/39 (71%) Frame = -3 Query: 324 EENKKWYVIFNGPFPGIYDDWYKAAPHCTKIPGIIHKSY 208 + K++YVIFNGP GIYD+W+KAAPH IIHK Y Sbjct: 17 KSKKEYYVIFNGPMKGIYDEWHKAAPHIQGQSSIIHKKY 55 >ADX60614.1 transcriptional activator, partial [Blueberry red ringspot virus] Length = 149 Score = 55.8 bits (133), Expect = 2e-07 Identities = 23/36 (63%), Positives = 27/36 (75%) Frame = -3 Query: 315 KKWYVIFNGPFPGIYDDWYKAAPHCTKIPGIIHKSY 208 K++YVIFNGP GIYD+W+KAAPH IIHK Y Sbjct: 10 KEYYVIFNGPMKGIYDEWHKAAPHIQGQSNIIHKKY 45 >AEH95574.1 translational transactivator [Blueberry red ringspot virus] Length = 427 Score = 56.2 bits (134), Expect = 8e-07 Identities = 23/39 (58%), Positives = 28/39 (71%) Frame = -3 Query: 324 EENKKWYVIFNGPFPGIYDDWYKAAPHCTKIPGIIHKSY 208 + K++YVIFNGP GIYD+W+KAAPH IIHK Y Sbjct: 77 KSKKEYYVIFNGPMKGIYDEWHKAAPHIQGQSSIIHKKY 115 >AEQ49590.1 transciptional activator [Blueberry red ringspot virus] Length = 427 Score = 55.8 bits (133), Expect = 1e-06 Identities = 23/36 (63%), Positives = 27/36 (75%) Frame = -3 Query: 315 KKWYVIFNGPFPGIYDDWYKAAPHCTKIPGIIHKSY 208 K++YVIFNGP GIYD+W+KAAPH IIHK Y Sbjct: 80 KEYYVIFNGPMKGIYDEWHKAAPHIQGQSNIIHKKY 115 >AEE01493.1 translational transactivator [Blueberry red ringspot virus] Length = 427 Score = 55.8 bits (133), Expect = 1e-06 Identities = 23/36 (63%), Positives = 27/36 (75%) Frame = -3 Query: 315 KKWYVIFNGPFPGIYDDWYKAAPHCTKIPGIIHKSY 208 K++YVIFNGP GIYD+W+KAAPH IIHK Y Sbjct: 80 KEYYVIFNGPMKGIYDEWHKAAPHIQGKANIIHKKY 115 >ADX60611.2 transcriptional activator [Blueberry red ringspot virus] Length = 427 Score = 55.8 bits (133), Expect = 1e-06 Identities = 23/36 (63%), Positives = 27/36 (75%) Frame = -3 Query: 315 KKWYVIFNGPFPGIYDDWYKAAPHCTKIPGIIHKSY 208 K++YVIFNGP GIYD+W+KAAPH IIHK Y Sbjct: 80 KEYYVIFNGPMKGIYDEWHKAAPHIQGQANIIHKKY 115 >ADX60607.2 transcriptional activator [Blueberry red ringspot virus] Length = 427 Score = 55.8 bits (133), Expect = 1e-06 Identities = 23/36 (63%), Positives = 27/36 (75%) Frame = -3 Query: 315 KKWYVIFNGPFPGIYDDWYKAAPHCTKIPGIIHKSY 208 K++YVIFNGP GIYD+W+KAAPH IIHK Y Sbjct: 80 KEYYVIFNGPMKGIYDEWHKAAPHIQGQSNIIHKKY 115 >ADX60605.2 transcriptional activator [Blueberry red ringspot virus] Length = 427 Score = 55.8 bits (133), Expect = 1e-06 Identities = 23/36 (63%), Positives = 27/36 (75%) Frame = -3 Query: 315 KKWYVIFNGPFPGIYDDWYKAAPHCTKIPGIIHKSY 208 K++YVIFNGP GIYD+W+KAAPH IIHK Y Sbjct: 80 KEYYVIFNGPMKGIYDEWHKAAPHIQGQSNIIHKKY 115 >NP_395470.1 putative translational transactivator [Blueberry red ringspot virus] AAL13275.1 putative translational transactivator [Blueberry red ringspot virus] Length = 428 Score = 55.8 bits (133), Expect = 1e-06 Identities = 23/36 (63%), Positives = 27/36 (75%) Frame = -3 Query: 315 KKWYVIFNGPFPGIYDDWYKAAPHCTKIPGIIHKSY 208 K++YVIFNGP GIYD+W+KAAPH IIHK Y Sbjct: 80 KEYYVIFNGPMKGIYDEWHKAAPHIQGQSSIIHKKY 115 >ADX60613.1 transcriptional activator, partial [Blueberry red ringspot virus] Length = 151 Score = 53.9 bits (128), Expect = 1e-06 Identities = 22/39 (56%), Positives = 28/39 (71%) Frame = -3 Query: 324 EENKKWYVIFNGPFPGIYDDWYKAAPHCTKIPGIIHKSY 208 + K++YVIFNGP GIYD+W+KAAP+ IIHK Y Sbjct: 9 KSKKEYYVIFNGPMKGIYDEWHKAAPYIQGQSSIIHKKY 47 >ADX60609.1 transcriptional activator, partial [Blueberry red ringspot virus] Length = 151 Score = 53.5 bits (127), Expect = 2e-06 Identities = 22/36 (61%), Positives = 27/36 (75%) Frame = -3 Query: 315 KKWYVIFNGPFPGIYDDWYKAAPHCTKIPGIIHKSY 208 K++YVIFNGP GIYD+W+KAAP+ IIHK Y Sbjct: 10 KEYYVIFNGPMKGIYDEWHKAAPYIQGQSNIIHKKY 45 >NP_042514.1 hypothetical protein [Peanut chlorotic streak virus] AAA50241.1 putative transactivation protein [Peanut chlorotic streak virus] Length = 420 Score = 53.9 bits (128), Expect = 5e-06 Identities = 36/110 (32%), Positives = 53/110 (48%) Frame = -3 Query: 339 KNQDEEENKKWYVIFNGPFPGIYDDWYKAAPHCTKIPGIIHKSYSSXXXXXXXXXXXXXX 160 K +EE K++YVI+NGP GIYD+W KA+ T + GI HK + S Sbjct: 70 KYDEEERAKRYYVIYNGPGKGIYDEWGKASLFITGVKGIRHKKFLS-----KKEAQDSFN 124 Query: 159 ERKKKGKEIYLGPRTFSETAKSSPPIKSGMKILGRILSSLDDFQIISRKD 10 E K+ + + + E +S P S M LG+I S I+++ D Sbjct: 125 EENKEAAKTAEVSKAYLEKLQSPKPQTSRMVNLGKIPSPRTIDHILTKAD 174