BLASTX nr result
ID: Glycyrrhiza36_contig00027040
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza36_contig00027040 (358 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_003606465.1 hypothetical protein MTR_4g060630 [Medicago trunc... 67 1e-11 >XP_003606465.1 hypothetical protein MTR_4g060630 [Medicago truncatula] AES88662.1 hypothetical protein MTR_4g060630 [Medicago truncatula] Length = 129 Score = 66.6 bits (161), Expect = 1e-11 Identities = 31/53 (58%), Positives = 38/53 (71%), Gaps = 2/53 (3%) Frame = -3 Query: 203 RVL*YSSPYP*FEKISIPVPIPTWVATLLPVPLSSGYLD--TRTHYPHFYNEK 51 RVL SPYP F+K+ +PVP+P+W TL+ P+S GYL TRTHYPHF EK Sbjct: 69 RVLQCPSPYPHFKKLPVPVPVPSWETTLVSFPISYGYLSVHTRTHYPHFNYEK 121