BLASTX nr result
ID: Glycyrrhiza36_contig00026218
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza36_contig00026218 (380 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value KJB33437.1 hypothetical protein B456_006G011100 [Gossypium raimo... 80 4e-16 KHG26758.1 Biotin carboxyl carrier of acetyl-CoA carboxylase 2, ... 81 5e-16 XP_017610839.1 PREDICTED: biotin carboxyl carrier protein of ace... 81 5e-16 KJB33436.1 hypothetical protein B456_006G011100 [Gossypium raimo... 80 6e-16 KJB33439.1 hypothetical protein B456_006G011100 [Gossypium raimo... 80 7e-16 XP_015879793.1 PREDICTED: biotin carboxyl carrier protein of ace... 80 8e-16 XP_015879792.1 PREDICTED: biotin carboxyl carrier protein of ace... 80 1e-15 XP_012483505.1 PREDICTED: biotin carboxyl carrier protein of ace... 80 1e-15 XP_012460343.1 PREDICTED: biotin carboxyl carrier protein of ace... 80 2e-15 KJB75634.1 hypothetical protein B456_012G049400 [Gossypium raimo... 80 2e-15 XP_016668183.1 PREDICTED: biotin carboxyl carrier protein of ace... 79 3e-15 XP_016672945.1 PREDICTED: biotin carboxyl carrier protein of ace... 79 4e-15 XP_007029252.1 PREDICTED: biotin carboxyl carrier protein of ace... 79 5e-15 KJB66287.1 hypothetical protein B456_010G135200 [Gossypium raimo... 76 7e-15 EOY09756.1 Biotin carboxyl carrier protein subunit of of Het-ACC... 79 7e-15 OMO85899.1 Biotin/lipoyl attachment [Corchorus olitorius] 78 8e-15 XP_003618716.1 biotin carboxyl carrier acetyl-CoA carboxylase [M... 78 1e-14 XP_004489456.1 PREDICTED: biotin carboxyl carrier protein of ace... 78 1e-14 XP_016752201.1 PREDICTED: biotin carboxyl carrier protein of ace... 78 1e-14 XP_016722270.1 PREDICTED: biotin carboxyl carrier protein of ace... 78 1e-14 >KJB33437.1 hypothetical protein B456_006G011100 [Gossypium raimondii] KJB33438.1 hypothetical protein B456_006G011100 [Gossypium raimondii] Length = 201 Score = 80.1 bits (196), Expect = 4e-16 Identities = 39/42 (92%), Positives = 41/42 (97%) Frame = +2 Query: 2 CIIEAMKLMNEIEADQSGTITDILVEDGKSVSVDMPLFVIVP 127 CIIEAMKLMNEIEADQSGTIT+IL EDGK+VSVDMPLFVIVP Sbjct: 160 CIIEAMKLMNEIEADQSGTITEILAEDGKAVSVDMPLFVIVP 201 >KHG26758.1 Biotin carboxyl carrier of acetyl-CoA carboxylase 2, chloroplastic -like protein [Gossypium arboreum] Length = 270 Score = 81.3 bits (199), Expect = 5e-16 Identities = 40/42 (95%), Positives = 41/42 (97%) Frame = +2 Query: 2 CIIEAMKLMNEIEADQSGTITDILVEDGKSVSVDMPLFVIVP 127 CIIEAMKLMNEIEADQSGTIT+IL EDGKSVSVDMPLFVIVP Sbjct: 229 CIIEAMKLMNEIEADQSGTITEILAEDGKSVSVDMPLFVIVP 270 >XP_017610839.1 PREDICTED: biotin carboxyl carrier protein of acetyl-CoA carboxylase 2, chloroplastic [Gossypium arboreum] Length = 284 Score = 81.3 bits (199), Expect = 5e-16 Identities = 40/42 (95%), Positives = 41/42 (97%) Frame = +2 Query: 2 CIIEAMKLMNEIEADQSGTITDILVEDGKSVSVDMPLFVIVP 127 CIIEAMKLMNEIEADQSGTIT+IL EDGKSVSVDMPLFVIVP Sbjct: 243 CIIEAMKLMNEIEADQSGTITEILAEDGKSVSVDMPLFVIVP 284 >KJB33436.1 hypothetical protein B456_006G011100 [Gossypium raimondii] Length = 226 Score = 80.1 bits (196), Expect = 6e-16 Identities = 39/42 (92%), Positives = 41/42 (97%) Frame = +2 Query: 2 CIIEAMKLMNEIEADQSGTITDILVEDGKSVSVDMPLFVIVP 127 CIIEAMKLMNEIEADQSGTIT+IL EDGK+VSVDMPLFVIVP Sbjct: 185 CIIEAMKLMNEIEADQSGTITEILAEDGKAVSVDMPLFVIVP 226 >KJB33439.1 hypothetical protein B456_006G011100 [Gossypium raimondii] Length = 233 Score = 80.1 bits (196), Expect = 7e-16 Identities = 39/42 (92%), Positives = 41/42 (97%) Frame = +2 Query: 2 CIIEAMKLMNEIEADQSGTITDILVEDGKSVSVDMPLFVIVP 127 CIIEAMKLMNEIEADQSGTIT+IL EDGK+VSVDMPLFVIVP Sbjct: 192 CIIEAMKLMNEIEADQSGTITEILAEDGKAVSVDMPLFVIVP 233 >XP_015879793.1 PREDICTED: biotin carboxyl carrier protein of acetyl-CoA carboxylase 2, chloroplastic isoform X2 [Ziziphus jujuba] Length = 267 Score = 80.5 bits (197), Expect = 8e-16 Identities = 39/42 (92%), Positives = 41/42 (97%) Frame = +2 Query: 2 CIIEAMKLMNEIEADQSGTITDILVEDGKSVSVDMPLFVIVP 127 CIIEAMKLMNEIEADQSGT+T+ILVEDGK VSVDMPLFVIVP Sbjct: 226 CIIEAMKLMNEIEADQSGTVTEILVEDGKPVSVDMPLFVIVP 267 >XP_015879792.1 PREDICTED: biotin carboxyl carrier protein of acetyl-CoA carboxylase 2, chloroplastic isoform X1 [Ziziphus jujuba] Length = 282 Score = 80.5 bits (197), Expect = 1e-15 Identities = 39/42 (92%), Positives = 41/42 (97%) Frame = +2 Query: 2 CIIEAMKLMNEIEADQSGTITDILVEDGKSVSVDMPLFVIVP 127 CIIEAMKLMNEIEADQSGT+T+ILVEDGK VSVDMPLFVIVP Sbjct: 241 CIIEAMKLMNEIEADQSGTVTEILVEDGKPVSVDMPLFVIVP 282 >XP_012483505.1 PREDICTED: biotin carboxyl carrier protein of acetyl-CoA carboxylase 2, chloroplastic [Gossypium raimondii] KJB33440.1 hypothetical protein B456_006G011100 [Gossypium raimondii] Length = 284 Score = 80.1 bits (196), Expect = 1e-15 Identities = 39/42 (92%), Positives = 41/42 (97%) Frame = +2 Query: 2 CIIEAMKLMNEIEADQSGTITDILVEDGKSVSVDMPLFVIVP 127 CIIEAMKLMNEIEADQSGTIT+IL EDGK+VSVDMPLFVIVP Sbjct: 243 CIIEAMKLMNEIEADQSGTITEILAEDGKAVSVDMPLFVIVP 284 >XP_012460343.1 PREDICTED: biotin carboxyl carrier protein of acetyl-CoA carboxylase 2, chloroplastic-like [Gossypium raimondii] KJB75633.1 hypothetical protein B456_012G049400 [Gossypium raimondii] Length = 290 Score = 79.7 bits (195), Expect = 2e-15 Identities = 39/41 (95%), Positives = 41/41 (100%) Frame = +2 Query: 2 CIIEAMKLMNEIEADQSGTITDILVEDGKSVSVDMPLFVIV 124 CIIEAMKLMNEIEADQSGT+T+ILVEDGKSVSVDMPLFVIV Sbjct: 249 CIIEAMKLMNEIEADQSGTVTEILVEDGKSVSVDMPLFVIV 289 >KJB75634.1 hypothetical protein B456_012G049400 [Gossypium raimondii] Length = 291 Score = 79.7 bits (195), Expect = 2e-15 Identities = 39/41 (95%), Positives = 41/41 (100%) Frame = +2 Query: 2 CIIEAMKLMNEIEADQSGTITDILVEDGKSVSVDMPLFVIV 124 CIIEAMKLMNEIEADQSGT+T+ILVEDGKSVSVDMPLFVIV Sbjct: 250 CIIEAMKLMNEIEADQSGTVTEILVEDGKSVSVDMPLFVIV 290 >XP_016668183.1 PREDICTED: biotin carboxyl carrier protein of acetyl-CoA carboxylase 2, chloroplastic-like [Gossypium hirsutum] Length = 284 Score = 79.3 bits (194), Expect = 3e-15 Identities = 39/42 (92%), Positives = 40/42 (95%) Frame = +2 Query: 2 CIIEAMKLMNEIEADQSGTITDILVEDGKSVSVDMPLFVIVP 127 CIIEAMKLMNEIEADQSGTIT+IL EDGK VSVDMPLFVIVP Sbjct: 243 CIIEAMKLMNEIEADQSGTITEILAEDGKPVSVDMPLFVIVP 284 >XP_016672945.1 PREDICTED: biotin carboxyl carrier protein of acetyl-CoA carboxylase 2, chloroplastic-like [Gossypium hirsutum] Length = 284 Score = 79.0 bits (193), Expect = 4e-15 Identities = 38/42 (90%), Positives = 41/42 (97%) Frame = +2 Query: 2 CIIEAMKLMNEIEADQSGTITDILVEDGKSVSVDMPLFVIVP 127 CIIEAMKLMNEIEADQSGTIT+I+ EDGK+VSVDMPLFVIVP Sbjct: 243 CIIEAMKLMNEIEADQSGTITEIVAEDGKAVSVDMPLFVIVP 284 >XP_007029252.1 PREDICTED: biotin carboxyl carrier protein of acetyl-CoA carboxylase, chloroplastic isoform X1 [Theobroma cacao] EOY09754.1 Biotin carboxyl carrier protein subunit of of Het-ACCase (BCCP1), putative isoform 1 [Theobroma cacao] Length = 279 Score = 78.6 bits (192), Expect = 5e-15 Identities = 39/42 (92%), Positives = 40/42 (95%) Frame = +2 Query: 2 CIIEAMKLMNEIEADQSGTITDILVEDGKSVSVDMPLFVIVP 127 CIIEAMKLMNEIEADQSGTI +ILVEDGKSVSVDMPLFVI P Sbjct: 238 CIIEAMKLMNEIEADQSGTIVEILVEDGKSVSVDMPLFVIEP 279 >KJB66287.1 hypothetical protein B456_010G135200 [Gossypium raimondii] Length = 161 Score = 75.9 bits (185), Expect = 7e-15 Identities = 37/42 (88%), Positives = 39/42 (92%) Frame = +2 Query: 2 CIIEAMKLMNEIEADQSGTITDILVEDGKSVSVDMPLFVIVP 127 CIIEAMKLMNEIEADQSGTI +IL EDGK+VSVDMPLFVI P Sbjct: 120 CIIEAMKLMNEIEADQSGTIVEILAEDGKAVSVDMPLFVIEP 161 >EOY09756.1 Biotin carboxyl carrier protein subunit of of Het-ACCase (BCCP1), putative isoform 3 [Theobroma cacao] Length = 310 Score = 78.6 bits (192), Expect = 7e-15 Identities = 39/42 (92%), Positives = 40/42 (95%) Frame = +2 Query: 2 CIIEAMKLMNEIEADQSGTITDILVEDGKSVSVDMPLFVIVP 127 CIIEAMKLMNEIEADQSGTI +ILVEDGKSVSVDMPLFVI P Sbjct: 269 CIIEAMKLMNEIEADQSGTIVEILVEDGKSVSVDMPLFVIEP 310 >OMO85899.1 Biotin/lipoyl attachment [Corchorus olitorius] Length = 290 Score = 78.2 bits (191), Expect = 8e-15 Identities = 39/42 (92%), Positives = 40/42 (95%) Frame = +2 Query: 2 CIIEAMKLMNEIEADQSGTITDILVEDGKSVSVDMPLFVIVP 127 CIIEAMKLMNEIEADQSGTIT+ILVEDGK VSVDMPL VIVP Sbjct: 249 CIIEAMKLMNEIEADQSGTITEILVEDGKPVSVDMPLVVIVP 290 >XP_003618716.1 biotin carboxyl carrier acetyl-CoA carboxylase [Medicago truncatula] AES74934.1 biotin carboxyl carrier acetyl-CoA carboxylase [Medicago truncatula] Length = 278 Score = 77.8 bits (190), Expect = 1e-14 Identities = 38/42 (90%), Positives = 40/42 (95%) Frame = +2 Query: 2 CIIEAMKLMNEIEADQSGTITDILVEDGKSVSVDMPLFVIVP 127 CIIEAMKLMNEIEADQSGTI +ILVEDGK VSVD+PLFVIVP Sbjct: 237 CIIEAMKLMNEIEADQSGTIAEILVEDGKPVSVDLPLFVIVP 278 >XP_004489456.1 PREDICTED: biotin carboxyl carrier protein of acetyl-CoA carboxylase 1, chloroplastic isoform X2 [Cicer arietinum] Length = 282 Score = 77.8 bits (190), Expect = 1e-14 Identities = 37/42 (88%), Positives = 40/42 (95%) Frame = +2 Query: 2 CIIEAMKLMNEIEADQSGTITDILVEDGKSVSVDMPLFVIVP 127 CIIEAMKLMNEIEADQSGTIT+ILVEDGK VS+D+PLFVI P Sbjct: 241 CIIEAMKLMNEIEADQSGTITEILVEDGKPVSIDLPLFVIAP 282 >XP_016752201.1 PREDICTED: biotin carboxyl carrier protein of acetyl-CoA carboxylase 2, chloroplastic-like [Gossypium hirsutum] Length = 290 Score = 77.8 bits (190), Expect = 1e-14 Identities = 38/41 (92%), Positives = 40/41 (97%) Frame = +2 Query: 2 CIIEAMKLMNEIEADQSGTITDILVEDGKSVSVDMPLFVIV 124 CIIEAMKLMNEIEADQSGT+T+ILVEDGK VSVDMPLFVIV Sbjct: 249 CIIEAMKLMNEIEADQSGTVTEILVEDGKPVSVDMPLFVIV 289 >XP_016722270.1 PREDICTED: biotin carboxyl carrier protein of acetyl-CoA carboxylase 2, chloroplastic-like [Gossypium hirsutum] Length = 290 Score = 77.8 bits (190), Expect = 1e-14 Identities = 38/41 (92%), Positives = 40/41 (97%) Frame = +2 Query: 2 CIIEAMKLMNEIEADQSGTITDILVEDGKSVSVDMPLFVIV 124 CIIEAMKLMNEIEADQSGT+T+ILVEDGK VSVDMPLFVIV Sbjct: 249 CIIEAMKLMNEIEADQSGTVTEILVEDGKPVSVDMPLFVIV 289