BLASTX nr result
ID: Glycyrrhiza36_contig00021858
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza36_contig00021858 (663 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AOO95281.1 alpha-tubulin, partial [Tinca tinca] 59 1e-08 JAU62161.1 Tubulin alpha chain, partial [Noccaea caerulescens] 59 3e-08 JAU52700.1 Tubulin alpha chain, partial [Noccaea caerulescens] 59 3e-08 KNA02792.1 hypothetical protein SOVF_215330, partial [Spinacia o... 59 3e-08 XP_009609032.1 PREDICTED: tubulin alpha chain, partial [Nicotian... 59 5e-08 JAU30054.1 Tubulin alpha chain, partial [Noccaea caerulescens] 59 5e-08 KFU98632.1 Tubulin alpha-1B chain, partial [Pterocles gutturalis] 58 5e-08 JAS81540.1 hypothetical protein g.6679, partial [Homalodisca lit... 59 5e-08 ALC74038.1 alpha tubulin 1, partial [Larix gmelinii var. olgensis] 59 6e-08 JAU26257.1 Tubulin alpha chain, partial [Noccaea caerulescens] J... 59 6e-08 KFP32793.1 Tubulin alpha chain, partial [Colius striatus] 58 6e-08 JAU99314.1 Tubulin alpha chain, partial [Noccaea caerulescens] 59 6e-08 KFV00377.1 Tubulin alpha-3 chain, partial [Pterocles gutturalis] 57 7e-08 KFO84796.1 Tubulin alpha chain, partial [Buceros rhinoceros silv... 58 8e-08 XP_014021153.1 PREDICTED: tubulin alpha chain-like [Salmo salar] 59 8e-08 JAU28075.1 Tubulin alpha chain, partial [Noccaea caerulescens] 59 8e-08 KFP71502.1 Tubulin alpha-3E chain, partial [Acanthisitta chloris] 58 8e-08 XP_009081498.1 PREDICTED: tubulin alpha chain, partial [Acanthis... 58 8e-08 SBS90820.1 tubulin alpha chain [Plasmodium ovale curtisi] 59 8e-08 XP_018465446.1 PREDICTED: tubulin alpha-3 chain-like, partial [R... 59 9e-08 >AOO95281.1 alpha-tubulin, partial [Tinca tinca] Length = 47 Score = 58.9 bits (141), Expect = 1e-08 Identities = 27/27 (100%), Positives = 27/27 (100%) Frame = +1 Query: 463 EPTVIDEVRTGTYRQLFHPEQLISGKE 543 EPTVIDEVRTGTYRQLFHPEQLISGKE Sbjct: 8 EPTVIDEVRTGTYRQLFHPEQLISGKE 34 >JAU62161.1 Tubulin alpha chain, partial [Noccaea caerulescens] Length = 71 Score = 58.9 bits (141), Expect = 3e-08 Identities = 27/27 (100%), Positives = 27/27 (100%) Frame = +1 Query: 463 EPTVIDEVRTGTYRQLFHPEQLISGKE 543 EPTVIDEVRTGTYRQLFHPEQLISGKE Sbjct: 36 EPTVIDEVRTGTYRQLFHPEQLISGKE 62 >JAU52700.1 Tubulin alpha chain, partial [Noccaea caerulescens] Length = 79 Score = 58.9 bits (141), Expect = 3e-08 Identities = 27/27 (100%), Positives = 27/27 (100%) Frame = +1 Query: 463 EPTVIDEVRTGTYRQLFHPEQLISGKE 543 EPTVIDEVRTGTYRQLFHPEQLISGKE Sbjct: 45 EPTVIDEVRTGTYRQLFHPEQLISGKE 71 >KNA02792.1 hypothetical protein SOVF_215330, partial [Spinacia oleracea] Length = 79 Score = 58.9 bits (141), Expect = 3e-08 Identities = 27/27 (100%), Positives = 27/27 (100%) Frame = +1 Query: 463 EPTVIDEVRTGTYRQLFHPEQLISGKE 543 EPTVIDEVRTGTYRQLFHPEQLISGKE Sbjct: 40 EPTVIDEVRTGTYRQLFHPEQLISGKE 66 >XP_009609032.1 PREDICTED: tubulin alpha chain, partial [Nicotiana tomentosiformis] Length = 94 Score = 58.9 bits (141), Expect = 5e-08 Identities = 27/27 (100%), Positives = 27/27 (100%) Frame = +1 Query: 463 EPTVIDEVRTGTYRQLFHPEQLISGKE 543 EPTVIDEVRTGTYRQLFHPEQLISGKE Sbjct: 40 EPTVIDEVRTGTYRQLFHPEQLISGKE 66 >JAU30054.1 Tubulin alpha chain, partial [Noccaea caerulescens] Length = 96 Score = 58.9 bits (141), Expect = 5e-08 Identities = 27/27 (100%), Positives = 27/27 (100%) Frame = +1 Query: 463 EPTVIDEVRTGTYRQLFHPEQLISGKE 543 EPTVIDEVRTGTYRQLFHPEQLISGKE Sbjct: 49 EPTVIDEVRTGTYRQLFHPEQLISGKE 75 >KFU98632.1 Tubulin alpha-1B chain, partial [Pterocles gutturalis] Length = 60 Score = 57.8 bits (138), Expect = 5e-08 Identities = 26/27 (96%), Positives = 27/27 (100%) Frame = +1 Query: 463 EPTVIDEVRTGTYRQLFHPEQLISGKE 543 EPTVIDEVRTGTYRQLFHPEQLI+GKE Sbjct: 8 EPTVIDEVRTGTYRQLFHPEQLITGKE 34 >JAS81540.1 hypothetical protein g.6679, partial [Homalodisca liturata] Length = 101 Score = 58.9 bits (141), Expect = 5e-08 Identities = 26/31 (83%), Positives = 28/31 (90%) Frame = +1 Query: 451 VAAFEPTVIDEVRTGTYRQLFHPEQLISGKE 543 + EPTVIDE+RTGTYRQLFHPEQLISGKE Sbjct: 69 IVDLEPTVIDEIRTGTYRQLFHPEQLISGKE 99 >ALC74038.1 alpha tubulin 1, partial [Larix gmelinii var. olgensis] Length = 102 Score = 58.9 bits (141), Expect = 6e-08 Identities = 27/27 (100%), Positives = 27/27 (100%) Frame = +1 Query: 463 EPTVIDEVRTGTYRQLFHPEQLISGKE 543 EPTVIDEVRTGTYRQLFHPEQLISGKE Sbjct: 71 EPTVIDEVRTGTYRQLFHPEQLISGKE 97 >JAU26257.1 Tubulin alpha chain, partial [Noccaea caerulescens] JAU42023.1 Tubulin alpha chain, partial [Noccaea caerulescens] Length = 103 Score = 58.9 bits (141), Expect = 6e-08 Identities = 27/27 (100%), Positives = 27/27 (100%) Frame = +1 Query: 463 EPTVIDEVRTGTYRQLFHPEQLISGKE 543 EPTVIDEVRTGTYRQLFHPEQLISGKE Sbjct: 68 EPTVIDEVRTGTYRQLFHPEQLISGKE 94 >KFP32793.1 Tubulin alpha chain, partial [Colius striatus] Length = 64 Score = 57.8 bits (138), Expect = 6e-08 Identities = 26/27 (96%), Positives = 27/27 (100%) Frame = +1 Query: 463 EPTVIDEVRTGTYRQLFHPEQLISGKE 543 EPTVIDEVRTGTYRQLFHPEQLI+GKE Sbjct: 12 EPTVIDEVRTGTYRQLFHPEQLITGKE 38 >JAU99314.1 Tubulin alpha chain, partial [Noccaea caerulescens] Length = 106 Score = 58.9 bits (141), Expect = 6e-08 Identities = 27/27 (100%), Positives = 27/27 (100%) Frame = +1 Query: 463 EPTVIDEVRTGTYRQLFHPEQLISGKE 543 EPTVIDEVRTGTYRQLFHPEQLISGKE Sbjct: 71 EPTVIDEVRTGTYRQLFHPEQLISGKE 97 >KFV00377.1 Tubulin alpha-3 chain, partial [Pterocles gutturalis] Length = 60 Score = 57.4 bits (137), Expect = 7e-08 Identities = 25/27 (92%), Positives = 27/27 (100%) Frame = +1 Query: 463 EPTVIDEVRTGTYRQLFHPEQLISGKE 543 EPTV+DEVRTGTYRQLFHPEQLI+GKE Sbjct: 8 EPTVVDEVRTGTYRQLFHPEQLITGKE 34 >KFO84796.1 Tubulin alpha chain, partial [Buceros rhinoceros silvestris] Length = 74 Score = 57.8 bits (138), Expect = 8e-08 Identities = 26/27 (96%), Positives = 27/27 (100%) Frame = +1 Query: 463 EPTVIDEVRTGTYRQLFHPEQLISGKE 543 EPTVIDEVRTGTYRQLFHPEQLI+GKE Sbjct: 22 EPTVIDEVRTGTYRQLFHPEQLITGKE 48 >XP_014021153.1 PREDICTED: tubulin alpha chain-like [Salmo salar] Length = 116 Score = 58.9 bits (141), Expect = 8e-08 Identities = 27/27 (100%), Positives = 27/27 (100%) Frame = +1 Query: 463 EPTVIDEVRTGTYRQLFHPEQLISGKE 543 EPTVIDEVRTGTYRQLFHPEQLISGKE Sbjct: 56 EPTVIDEVRTGTYRQLFHPEQLISGKE 82 >JAU28075.1 Tubulin alpha chain, partial [Noccaea caerulescens] Length = 117 Score = 58.9 bits (141), Expect = 8e-08 Identities = 27/27 (100%), Positives = 27/27 (100%) Frame = +1 Query: 463 EPTVIDEVRTGTYRQLFHPEQLISGKE 543 EPTVIDEVRTGTYRQLFHPEQLISGKE Sbjct: 71 EPTVIDEVRTGTYRQLFHPEQLISGKE 97 >KFP71502.1 Tubulin alpha-3E chain, partial [Acanthisitta chloris] Length = 76 Score = 57.8 bits (138), Expect = 8e-08 Identities = 26/27 (96%), Positives = 27/27 (100%) Frame = +1 Query: 463 EPTVIDEVRTGTYRQLFHPEQLISGKE 543 EPTVIDEVRTGTYRQLFHPEQLI+GKE Sbjct: 24 EPTVIDEVRTGTYRQLFHPEQLITGKE 50 >XP_009081498.1 PREDICTED: tubulin alpha chain, partial [Acanthisitta chloris] Length = 77 Score = 57.8 bits (138), Expect = 8e-08 Identities = 26/27 (96%), Positives = 27/27 (100%) Frame = +1 Query: 463 EPTVIDEVRTGTYRQLFHPEQLISGKE 543 EPTVIDEVRTGTYRQLFHPEQLI+GKE Sbjct: 23 EPTVIDEVRTGTYRQLFHPEQLITGKE 49 >SBS90820.1 tubulin alpha chain [Plasmodium ovale curtisi] Length = 106 Score = 58.5 bits (140), Expect = 8e-08 Identities = 26/27 (96%), Positives = 27/27 (100%) Frame = +1 Query: 463 EPTVIDEVRTGTYRQLFHPEQLISGKE 543 EPTV+DEVRTGTYRQLFHPEQLISGKE Sbjct: 48 EPTVVDEVRTGTYRQLFHPEQLISGKE 74 >XP_018465446.1 PREDICTED: tubulin alpha-3 chain-like, partial [Raphanus sativus] Length = 124 Score = 58.9 bits (141), Expect = 9e-08 Identities = 27/27 (100%), Positives = 27/27 (100%) Frame = +1 Query: 463 EPTVIDEVRTGTYRQLFHPEQLISGKE 543 EPTVIDEVRTGTYRQLFHPEQLISGKE Sbjct: 71 EPTVIDEVRTGTYRQLFHPEQLISGKE 97