BLASTX nr result
ID: Glycyrrhiza36_contig00019111
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza36_contig00019111 (445 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_007146977.1 hypothetical protein PHAVU_006G0865001g, partial ... 79 6e-16 XP_016190330.1 PREDICTED: FACT complex subunit SPT16 isoform X3 ... 82 2e-15 XP_016190329.1 PREDICTED: FACT complex subunit SPT16 isoform X2 ... 82 2e-15 XP_015956688.1 PREDICTED: FACT complex subunit SPT16-like [Arach... 82 2e-15 KHN24177.1 FACT complex subunit SPT16 [Glycine soja] 81 4e-15 XP_006591307.1 PREDICTED: FACT complex subunit SPT16-like [Glyci... 81 4e-15 KHN08767.1 FACT complex subunit SPT16 [Glycine soja] 81 6e-15 XP_003553020.1 PREDICTED: FACT complex subunit SPT16-like isofor... 81 6e-15 XP_014626356.1 PREDICTED: FACT complex subunit SPT16-like isofor... 81 6e-15 XP_006602030.1 PREDICTED: FACT complex subunit SPT16-like isofor... 81 6e-15 XP_004503090.1 PREDICTED: FACT complex subunit SPT16 [Cicer arie... 80 8e-15 XP_015956689.1 PREDICTED: FACT complex subunit SPT16-like [Arach... 80 1e-14 KYP76019.1 FACT complex subunit SPT16 [Cajanus cajan] 80 1e-14 XP_019439526.1 PREDICTED: FACT complex subunit SPT16-like [Lupin... 79 2e-14 XP_007146975.1 hypothetical protein PHAVU_006G0864001g, partial ... 79 3e-14 OIV89361.1 hypothetical protein TanjilG_22693, partial [Lupinus ... 79 3e-14 XP_019434795.1 PREDICTED: FACT complex subunit SPT16-like isofor... 79 4e-14 BAT88138.1 hypothetical protein VIGAN_05158300 [Vigna angularis ... 79 4e-14 XP_017436588.1 PREDICTED: FACT complex subunit SPT16-like [Vigna... 79 4e-14 XP_009366049.1 PREDICTED: FACT complex subunit SPT16-like [Pyrus... 78 5e-14 >XP_007146977.1 hypothetical protein PHAVU_006G0865001g, partial [Phaseolus vulgaris] XP_007146978.1 hypothetical protein PHAVU_006G0865001g, partial [Phaseolus vulgaris] ESW18971.1 hypothetical protein PHAVU_006G0865001g, partial [Phaseolus vulgaris] ESW18972.1 hypothetical protein PHAVU_006G0865001g, partial [Phaseolus vulgaris] Length = 126 Score = 78.6 bits (192), Expect = 6e-16 Identities = 41/45 (91%), Positives = 43/45 (95%), Gaps = 1/45 (2%) Frame = -1 Query: 364 ASNADREKGNESDSEEDRKRRKAKAFGKSR-ASLSSSMPKRSKLR 233 ASNADREKGNESDSEEDRKRRKAK+FGKSR SLSSSMPKR+KLR Sbjct: 82 ASNADREKGNESDSEEDRKRRKAKSFGKSRGTSLSSSMPKRAKLR 126 >XP_016190330.1 PREDICTED: FACT complex subunit SPT16 isoform X3 [Arachis ipaensis] Length = 1067 Score = 82.0 bits (201), Expect = 2e-15 Identities = 40/44 (90%), Positives = 43/44 (97%) Frame = -1 Query: 364 ASNADREKGNESDSEEDRKRRKAKAFGKSRASLSSSMPKRSKLR 233 A+NADREKGN+SDSEEDRKRRKAKAFGKSRA LSSSMPKR+KLR Sbjct: 1024 ATNADREKGNDSDSEEDRKRRKAKAFGKSRAGLSSSMPKRAKLR 1067 >XP_016190329.1 PREDICTED: FACT complex subunit SPT16 isoform X2 [Arachis ipaensis] Length = 1067 Score = 82.0 bits (201), Expect = 2e-15 Identities = 40/44 (90%), Positives = 43/44 (97%) Frame = -1 Query: 364 ASNADREKGNESDSEEDRKRRKAKAFGKSRASLSSSMPKRSKLR 233 A+NADREKGN+SDSEEDRKRRKAKAFGKSRA LSSSMPKR+KLR Sbjct: 1024 ATNADREKGNDSDSEEDRKRRKAKAFGKSRAGLSSSMPKRAKLR 1067 >XP_015956688.1 PREDICTED: FACT complex subunit SPT16-like [Arachis duranensis] Length = 1067 Score = 82.0 bits (201), Expect = 2e-15 Identities = 40/44 (90%), Positives = 43/44 (97%) Frame = -1 Query: 364 ASNADREKGNESDSEEDRKRRKAKAFGKSRASLSSSMPKRSKLR 233 A+NADREKGN+SDSEEDRKRRKAKAFGKSRA LSSSMPKR+KLR Sbjct: 1024 ATNADREKGNDSDSEEDRKRRKAKAFGKSRAGLSSSMPKRAKLR 1067 >KHN24177.1 FACT complex subunit SPT16 [Glycine soja] Length = 1068 Score = 81.3 bits (199), Expect = 4e-15 Identities = 43/45 (95%), Positives = 44/45 (97%), Gaps = 1/45 (2%) Frame = -1 Query: 364 ASNADREKGNESDSEEDRKRRKAKAFGKSR-ASLSSSMPKRSKLR 233 ASNADREKGNESDSEEDRKRRKAK+FGKSR ASLSSSMPKRSKLR Sbjct: 1024 ASNADREKGNESDSEEDRKRRKAKSFGKSRGASLSSSMPKRSKLR 1068 >XP_006591307.1 PREDICTED: FACT complex subunit SPT16-like [Glycine max] XP_006591308.1 PREDICTED: FACT complex subunit SPT16-like [Glycine max] KRH20047.1 hypothetical protein GLYMA_13G152700 [Glycine max] Length = 1068 Score = 81.3 bits (199), Expect = 4e-15 Identities = 43/45 (95%), Positives = 44/45 (97%), Gaps = 1/45 (2%) Frame = -1 Query: 364 ASNADREKGNESDSEEDRKRRKAKAFGKSR-ASLSSSMPKRSKLR 233 ASNADREKGNESDSEEDRKRRKAK+FGKSR ASLSSSMPKRSKLR Sbjct: 1024 ASNADREKGNESDSEEDRKRRKAKSFGKSRGASLSSSMPKRSKLR 1068 >KHN08767.1 FACT complex subunit SPT16 [Glycine soja] Length = 1068 Score = 80.9 bits (198), Expect = 6e-15 Identities = 43/45 (95%), Positives = 43/45 (95%), Gaps = 1/45 (2%) Frame = -1 Query: 364 ASNADREKGNESDSEEDRKRRKAKAFGKSR-ASLSSSMPKRSKLR 233 ASNADREKGNESDSEEDRKRRKAK FGKSR ASLSSSMPKRSKLR Sbjct: 1024 ASNADREKGNESDSEEDRKRRKAKGFGKSRGASLSSSMPKRSKLR 1068 >XP_003553020.1 PREDICTED: FACT complex subunit SPT16-like isoform X3 [Glycine max] XP_006602031.1 PREDICTED: FACT complex subunit SPT16-like isoform X3 [Glycine max] KRG98015.1 hypothetical protein GLYMA_18G044600 [Glycine max] Length = 1068 Score = 80.9 bits (198), Expect = 6e-15 Identities = 43/45 (95%), Positives = 43/45 (95%), Gaps = 1/45 (2%) Frame = -1 Query: 364 ASNADREKGNESDSEEDRKRRKAKAFGKSR-ASLSSSMPKRSKLR 233 ASNADREKGNESDSEEDRKRRKAK FGKSR ASLSSSMPKRSKLR Sbjct: 1024 ASNADREKGNESDSEEDRKRRKAKGFGKSRGASLSSSMPKRSKLR 1068 >XP_014626356.1 PREDICTED: FACT complex subunit SPT16-like isoform X2 [Glycine max] Length = 1085 Score = 80.9 bits (198), Expect = 6e-15 Identities = 43/45 (95%), Positives = 43/45 (95%), Gaps = 1/45 (2%) Frame = -1 Query: 364 ASNADREKGNESDSEEDRKRRKAKAFGKSR-ASLSSSMPKRSKLR 233 ASNADREKGNESDSEEDRKRRKAK FGKSR ASLSSSMPKRSKLR Sbjct: 1041 ASNADREKGNESDSEEDRKRRKAKGFGKSRGASLSSSMPKRSKLR 1085 >XP_006602030.1 PREDICTED: FACT complex subunit SPT16-like isoform X1 [Glycine max] Length = 1090 Score = 80.9 bits (198), Expect = 6e-15 Identities = 43/45 (95%), Positives = 43/45 (95%), Gaps = 1/45 (2%) Frame = -1 Query: 364 ASNADREKGNESDSEEDRKRRKAKAFGKSR-ASLSSSMPKRSKLR 233 ASNADREKGNESDSEEDRKRRKAK FGKSR ASLSSSMPKRSKLR Sbjct: 1046 ASNADREKGNESDSEEDRKRRKAKGFGKSRGASLSSSMPKRSKLR 1090 >XP_004503090.1 PREDICTED: FACT complex subunit SPT16 [Cicer arietinum] Length = 1067 Score = 80.5 bits (197), Expect = 8e-15 Identities = 43/45 (95%), Positives = 43/45 (95%), Gaps = 1/45 (2%) Frame = -1 Query: 364 ASNADREKGNESDSEEDRKRRKAK-AFGKSRASLSSSMPKRSKLR 233 ASNADREKGNESDSEEDRKRRKAK AFGKSRASLSSSMPKR KLR Sbjct: 1023 ASNADREKGNESDSEEDRKRRKAKAAFGKSRASLSSSMPKRPKLR 1067 >XP_015956689.1 PREDICTED: FACT complex subunit SPT16-like [Arachis duranensis] XP_015956690.1 PREDICTED: FACT complex subunit SPT16-like [Arachis duranensis] XP_015956691.1 PREDICTED: FACT complex subunit SPT16-like [Arachis duranensis] XP_015956692.1 PREDICTED: FACT complex subunit SPT16-like [Arachis duranensis] Length = 1067 Score = 80.1 bits (196), Expect = 1e-14 Identities = 39/44 (88%), Positives = 41/44 (93%) Frame = -1 Query: 364 ASNADREKGNESDSEEDRKRRKAKAFGKSRASLSSSMPKRSKLR 233 A+NADREKGN+SDSEEDRKRRKAKAFGKSRA LS MPKRSKLR Sbjct: 1024 ATNADREKGNDSDSEEDRKRRKAKAFGKSRAGLSGGMPKRSKLR 1067 >KYP76019.1 FACT complex subunit SPT16 [Cajanus cajan] Length = 961 Score = 79.7 bits (195), Expect = 1e-14 Identities = 42/45 (93%), Positives = 43/45 (95%), Gaps = 1/45 (2%) Frame = -1 Query: 364 ASNADREKGNESDSEEDRKRRKAKAFGKSR-ASLSSSMPKRSKLR 233 ASNADREKGNESDSEEDRKRRKAK+FGKSR A LSSSMPKRSKLR Sbjct: 917 ASNADREKGNESDSEEDRKRRKAKSFGKSRGAGLSSSMPKRSKLR 961 >XP_019439526.1 PREDICTED: FACT complex subunit SPT16-like [Lupinus angustifolius] OIW14133.1 hypothetical protein TanjilG_21273 [Lupinus angustifolius] Length = 1066 Score = 79.3 bits (194), Expect = 2e-14 Identities = 39/44 (88%), Positives = 42/44 (95%) Frame = -1 Query: 364 ASNADREKGNESDSEEDRKRRKAKAFGKSRASLSSSMPKRSKLR 233 ASNADREKGNE DS+EDR+RRKAKAFGKSRA +SSSMPKRSKLR Sbjct: 1023 ASNADREKGNEYDSDEDRQRRKAKAFGKSRAGVSSSMPKRSKLR 1066 >XP_007146975.1 hypothetical protein PHAVU_006G0864001g, partial [Phaseolus vulgaris] ESW18969.1 hypothetical protein PHAVU_006G0864001g, partial [Phaseolus vulgaris] Length = 422 Score = 78.6 bits (192), Expect = 3e-14 Identities = 41/45 (91%), Positives = 43/45 (95%), Gaps = 1/45 (2%) Frame = -1 Query: 364 ASNADREKGNESDSEEDRKRRKAKAFGKSR-ASLSSSMPKRSKLR 233 ASNADREKGNESDSEEDRKRRKAK+FGKSR SLSSSMPKR+KLR Sbjct: 378 ASNADREKGNESDSEEDRKRRKAKSFGKSRGTSLSSSMPKRAKLR 422 >OIV89361.1 hypothetical protein TanjilG_22693, partial [Lupinus angustifolius] Length = 673 Score = 78.6 bits (192), Expect = 3e-14 Identities = 39/44 (88%), Positives = 41/44 (93%) Frame = -1 Query: 364 ASNADREKGNESDSEEDRKRRKAKAFGKSRASLSSSMPKRSKLR 233 ASNADREKGNE DS+EDR+RRKAKAFGKSRA SSSMPKRSKLR Sbjct: 630 ASNADREKGNEYDSDEDRQRRKAKAFGKSRAGASSSMPKRSKLR 673 >XP_019434795.1 PREDICTED: FACT complex subunit SPT16-like isoform X1 [Lupinus angustifolius] XP_019434796.1 PREDICTED: FACT complex subunit SPT16-like isoform X1 [Lupinus angustifolius] XP_019434797.1 PREDICTED: FACT complex subunit SPT16-like isoform X2 [Lupinus angustifolius] XP_019434798.1 PREDICTED: FACT complex subunit SPT16-like isoform X1 [Lupinus angustifolius] Length = 1067 Score = 78.6 bits (192), Expect = 4e-14 Identities = 39/44 (88%), Positives = 41/44 (93%) Frame = -1 Query: 364 ASNADREKGNESDSEEDRKRRKAKAFGKSRASLSSSMPKRSKLR 233 ASNADREKGNE DS+EDR+RRKAKAFGKSRA SSSMPKRSKLR Sbjct: 1024 ASNADREKGNEYDSDEDRQRRKAKAFGKSRAGASSSMPKRSKLR 1067 >BAT88138.1 hypothetical protein VIGAN_05158300 [Vigna angularis var. angularis] Length = 1068 Score = 78.6 bits (192), Expect = 4e-14 Identities = 41/45 (91%), Positives = 43/45 (95%), Gaps = 1/45 (2%) Frame = -1 Query: 364 ASNADREKGNESDSEEDRKRRKAKAFGKSR-ASLSSSMPKRSKLR 233 ASNADREKGNESDSEEDRKRRKAK+FGKSR +LSSSMPKRSKLR Sbjct: 1024 ASNADREKGNESDSEEDRKRRKAKSFGKSRGTNLSSSMPKRSKLR 1068 >XP_017436588.1 PREDICTED: FACT complex subunit SPT16-like [Vigna angularis] KOM52801.1 hypothetical protein LR48_Vigan09g146000 [Vigna angularis] Length = 1068 Score = 78.6 bits (192), Expect = 4e-14 Identities = 41/45 (91%), Positives = 43/45 (95%), Gaps = 1/45 (2%) Frame = -1 Query: 364 ASNADREKGNESDSEEDRKRRKAKAFGKSR-ASLSSSMPKRSKLR 233 ASNADREKGNESDSEEDRKRRKAK+FGKSR +LSSSMPKRSKLR Sbjct: 1024 ASNADREKGNESDSEEDRKRRKAKSFGKSRGTNLSSSMPKRSKLR 1068 >XP_009366049.1 PREDICTED: FACT complex subunit SPT16-like [Pyrus x bretschneideri] Length = 1069 Score = 78.2 bits (191), Expect = 5e-14 Identities = 39/44 (88%), Positives = 41/44 (93%) Frame = -1 Query: 364 ASNADREKGNESDSEEDRKRRKAKAFGKSRASLSSSMPKRSKLR 233 ASNADREKGNESDSEEDRKRRKAKAFGKSRA SS+PKRSK+R Sbjct: 1026 ASNADREKGNESDSEEDRKRRKAKAFGKSRAPPPSSIPKRSKMR 1069