BLASTX nr result
ID: Glycyrrhiza36_contig00018229
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza36_contig00018229 (248 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_014514380.1 PREDICTED: pentatricopeptide repeat-containing pr... 148 9e-41 XP_003556470.1 PREDICTED: pentatricopeptide repeat-containing pr... 148 9e-41 KYP74474.1 hypothetical protein KK1_007157 [Cajanus cajan] 147 2e-40 KHN22079.1 Pentatricopeptide repeat-containing protein, mitochon... 147 3e-40 XP_014618688.1 PREDICTED: pentatricopeptide repeat-containing pr... 147 3e-40 XP_003630353.2 PPR containing plant protein [Medicago truncatula... 147 3e-40 XP_007144829.1 hypothetical protein PHAVU_007G187600g [Phaseolus... 146 7e-40 XP_017440424.1 PREDICTED: pentatricopeptide repeat-containing pr... 144 3e-39 GAU25404.1 hypothetical protein TSUD_70560 [Trifolium subterraneum] 144 4e-39 XP_019464245.1 PREDICTED: pentatricopeptide repeat-containing pr... 144 6e-39 BAT94968.1 hypothetical protein VIGAN_08162000 [Vigna angularis ... 144 7e-39 XP_004503897.1 PREDICTED: pentatricopeptide repeat-containing pr... 137 2e-36 KHN04927.1 Pentatricopeptide repeat-containing protein, mitochon... 137 2e-36 ONI08906.1 hypothetical protein PRUPE_5G207600 [Prunus persica] 131 3e-34 XP_008240094.1 PREDICTED: pentatricopeptide repeat-containing pr... 131 3e-34 XP_008453300.1 PREDICTED: pentatricopeptide repeat-containing pr... 130 4e-34 XP_019082040.1 PREDICTED: pentatricopeptide repeat-containing pr... 130 7e-34 XP_009346139.1 PREDICTED: LOW QUALITY PROTEIN: pentatricopeptide... 129 3e-33 XP_008393245.1 PREDICTED: pentatricopeptide repeat-containing pr... 128 5e-33 XP_015943692.1 PREDICTED: pentatricopeptide repeat-containing pr... 127 9e-33 >XP_014514380.1 PREDICTED: pentatricopeptide repeat-containing protein PNM1, mitochondrial [Vigna radiata var. radiata] Length = 504 Score = 148 bits (374), Expect = 9e-41 Identities = 66/82 (80%), Positives = 77/82 (93%) Frame = -2 Query: 247 DPDSDPHSVSQHLHLSFSHITPTPDLVLQTLNLSTEAGRSVLGFHQWLASNPKFTHTDDT 68 +P+SDPHSVS+ LHLSFSHITPTPDL+LQTLNL +AGR+VLGFH WL+SNP+FTHTD T Sbjct: 74 EPNSDPHSVSKRLHLSFSHITPTPDLILQTLNLCPQAGRNVLGFHHWLSSNPQFTHTDHT 133 Query: 67 LSYFVDYFGRRKDFKATHEVLA 2 LSYFVDYFGRRKDFKATH++L+ Sbjct: 134 LSYFVDYFGRRKDFKATHDLLS 155 >XP_003556470.1 PREDICTED: pentatricopeptide repeat-containing protein PNM1, mitochondrial-like [Glycine max] KRG92684.1 hypothetical protein GLYMA_20G225100 [Glycine max] Length = 509 Score = 148 bits (374), Expect = 9e-41 Identities = 68/82 (82%), Positives = 78/82 (95%) Frame = -2 Query: 247 DPDSDPHSVSQHLHLSFSHITPTPDLVLQTLNLSTEAGRSVLGFHQWLASNPKFTHTDDT 68 +PDSD SVSQ LHLSFSHITPTP+L+LQTLNLS E+GR+VLGFHQWL+SNP+F+HTDDT Sbjct: 78 EPDSDALSVSQRLHLSFSHITPTPNLILQTLNLSHESGRTVLGFHQWLSSNPQFSHTDDT 137 Query: 67 LSYFVDYFGRRKDFKATHEVLA 2 LSYFVDYFGRRKDFKATH+VL+ Sbjct: 138 LSYFVDYFGRRKDFKATHDVLS 159 >KYP74474.1 hypothetical protein KK1_007157 [Cajanus cajan] Length = 511 Score = 147 bits (372), Expect = 2e-40 Identities = 67/82 (81%), Positives = 77/82 (93%) Frame = -2 Query: 247 DPDSDPHSVSQHLHLSFSHITPTPDLVLQTLNLSTEAGRSVLGFHQWLASNPKFTHTDDT 68 +PDSD +VSQ LHLSFSH+TPTP L+LQTLNLS EAGR+VLGFH+WLASNP+F+HTDDT Sbjct: 80 EPDSDSLAVSQRLHLSFSHVTPTPSLILQTLNLSPEAGRTVLGFHKWLASNPQFSHTDDT 139 Query: 67 LSYFVDYFGRRKDFKATHEVLA 2 LSYFVDYFGRRKDFKATH+VL+ Sbjct: 140 LSYFVDYFGRRKDFKATHDVLS 161 >KHN22079.1 Pentatricopeptide repeat-containing protein, mitochondrial [Glycine soja] Length = 509 Score = 147 bits (371), Expect = 3e-40 Identities = 68/82 (82%), Positives = 78/82 (95%) Frame = -2 Query: 247 DPDSDPHSVSQHLHLSFSHITPTPDLVLQTLNLSTEAGRSVLGFHQWLASNPKFTHTDDT 68 +PDSD SVSQ L+LSFSHITPTP+L+LQTLNLS +AGR+VLGFHQWL+SNP+F+HTDDT Sbjct: 77 EPDSDALSVSQRLNLSFSHITPTPNLILQTLNLSPQAGRTVLGFHQWLSSNPQFSHTDDT 136 Query: 67 LSYFVDYFGRRKDFKATHEVLA 2 LSYFVDYFGRRKDFKATH+VLA Sbjct: 137 LSYFVDYFGRRKDFKATHDVLA 158 >XP_014618688.1 PREDICTED: pentatricopeptide repeat-containing protein PNM1, mitochondrial-like [Glycine max] KRH34092.1 hypothetical protein GLYMA_10G162500 [Glycine max] Length = 509 Score = 147 bits (371), Expect = 3e-40 Identities = 68/82 (82%), Positives = 78/82 (95%) Frame = -2 Query: 247 DPDSDPHSVSQHLHLSFSHITPTPDLVLQTLNLSTEAGRSVLGFHQWLASNPKFTHTDDT 68 +PDSD SVSQ L+LSFSHITPTP+L+LQTLNLS +AGR+VLGFHQWL+SNP+F+HTDDT Sbjct: 77 EPDSDALSVSQRLNLSFSHITPTPNLILQTLNLSPQAGRTVLGFHQWLSSNPQFSHTDDT 136 Query: 67 LSYFVDYFGRRKDFKATHEVLA 2 LSYFVDYFGRRKDFKATH+VLA Sbjct: 137 LSYFVDYFGRRKDFKATHDVLA 158 >XP_003630353.2 PPR containing plant protein [Medicago truncatula] AFK45023.1 unknown [Medicago truncatula] AET04829.2 PPR containing plant protein [Medicago truncatula] Length = 521 Score = 147 bits (371), Expect = 3e-40 Identities = 67/82 (81%), Positives = 78/82 (95%) Frame = -2 Query: 247 DPDSDPHSVSQHLHLSFSHITPTPDLVLQTLNLSTEAGRSVLGFHQWLASNPKFTHTDDT 68 +PDSDP SV+Q L+LSFSHITPTP+L+L+TLNLS EAGR+VLGFHQWLASNPKFTHTD+T Sbjct: 90 EPDSDPSSVTQRLNLSFSHITPTPNLILETLNLSLEAGRNVLGFHQWLASNPKFTHTDET 149 Query: 67 LSYFVDYFGRRKDFKATHEVLA 2 LSYFVDYFGRRKDFKAT ++L+ Sbjct: 150 LSYFVDYFGRRKDFKATDKILS 171 >XP_007144829.1 hypothetical protein PHAVU_007G187600g [Phaseolus vulgaris] ESW16823.1 hypothetical protein PHAVU_007G187600g [Phaseolus vulgaris] Length = 505 Score = 146 bits (368), Expect = 7e-40 Identities = 67/80 (83%), Positives = 76/80 (95%) Frame = -2 Query: 241 DSDPHSVSQHLHLSFSHITPTPDLVLQTLNLSTEAGRSVLGFHQWLASNPKFTHTDDTLS 62 DSDP SVSQ LHLSFSHITPTP+L+LQTLNLS +AGR+VLGFHQWL+SNP+FTHTD TLS Sbjct: 76 DSDPLSVSQRLHLSFSHITPTPNLILQTLNLSPQAGRTVLGFHQWLSSNPQFTHTDHTLS 135 Query: 61 YFVDYFGRRKDFKATHEVLA 2 YFVDYFGRRKDFKATH++L+ Sbjct: 136 YFVDYFGRRKDFKATHDLLS 155 >XP_017440424.1 PREDICTED: pentatricopeptide repeat-containing protein PNM1, mitochondrial [Vigna angularis] KOM55089.1 hypothetical protein LR48_Vigan10g098100 [Vigna angularis] Length = 504 Score = 144 bits (363), Expect = 3e-39 Identities = 65/82 (79%), Positives = 76/82 (92%) Frame = -2 Query: 247 DPDSDPHSVSQHLHLSFSHITPTPDLVLQTLNLSTEAGRSVLGFHQWLASNPKFTHTDDT 68 +PDSDP SVS+ LHLS SH+TPTPDL+LQTLNL +AGR+VLGFHQWL+SNP+FTHTD T Sbjct: 74 EPDSDPLSVSKRLHLSNSHVTPTPDLILQTLNLCPQAGRNVLGFHQWLSSNPQFTHTDHT 133 Query: 67 LSYFVDYFGRRKDFKATHEVLA 2 LSYFVDYFGRRKDFKATH++L+ Sbjct: 134 LSYFVDYFGRRKDFKATHDLLS 155 >GAU25404.1 hypothetical protein TSUD_70560 [Trifolium subterraneum] Length = 519 Score = 144 bits (363), Expect = 4e-39 Identities = 66/81 (81%), Positives = 74/81 (91%) Frame = -2 Query: 247 DPDSDPHSVSQHLHLSFSHITPTPDLVLQTLNLSTEAGRSVLGFHQWLASNPKFTHTDDT 68 + DSDP +V++ LHLSFSHITPTPDLVLQTLNLS EAGR+VLGFHQWL SNPKFT TD+T Sbjct: 91 ESDSDPTAVAERLHLSFSHITPTPDLVLQTLNLSPEAGRNVLGFHQWLVSNPKFTQTDET 150 Query: 67 LSYFVDYFGRRKDFKATHEVL 5 LSYFVDYFGRR DFKATH++L Sbjct: 151 LSYFVDYFGRRNDFKATHKIL 171 >XP_019464245.1 PREDICTED: pentatricopeptide repeat-containing protein PNM1, mitochondrial [Lupinus angustifolius] OIV99967.1 hypothetical protein TanjilG_26305 [Lupinus angustifolius] Length = 523 Score = 144 bits (362), Expect = 6e-39 Identities = 68/82 (82%), Positives = 74/82 (90%) Frame = -2 Query: 247 DPDSDPHSVSQHLHLSFSHITPTPDLVLQTLNLSTEAGRSVLGFHQWLASNPKFTHTDDT 68 DPDSDP SVSQ LHLSFSHITPT DLVLQTLNLS +AGR+VLGFH WL SNPKFT+TD+T Sbjct: 85 DPDSDPVSVSQRLHLSFSHITPTSDLVLQTLNLSPDAGRTVLGFHLWLFSNPKFTYTDET 144 Query: 67 LSYFVDYFGRRKDFKATHEVLA 2 LS+FVDYFGRRKDFK HE+LA Sbjct: 145 LSFFVDYFGRRKDFKVIHELLA 166 >BAT94968.1 hypothetical protein VIGAN_08162000 [Vigna angularis var. angularis] Length = 559 Score = 144 bits (363), Expect = 7e-39 Identities = 65/82 (79%), Positives = 76/82 (92%) Frame = -2 Query: 247 DPDSDPHSVSQHLHLSFSHITPTPDLVLQTLNLSTEAGRSVLGFHQWLASNPKFTHTDDT 68 +PDSDP SVS+ LHLS SH+TPTPDL+LQTLNL +AGR+VLGFHQWL+SNP+FTHTD T Sbjct: 129 EPDSDPLSVSKRLHLSNSHVTPTPDLILQTLNLCPQAGRNVLGFHQWLSSNPQFTHTDHT 188 Query: 67 LSYFVDYFGRRKDFKATHEVLA 2 LSYFVDYFGRRKDFKATH++L+ Sbjct: 189 LSYFVDYFGRRKDFKATHDLLS 210 >XP_004503897.1 PREDICTED: pentatricopeptide repeat-containing protein PNM1, mitochondrial [Cicer arietinum] Length = 516 Score = 137 bits (345), Expect = 2e-36 Identities = 63/81 (77%), Positives = 73/81 (90%) Frame = -2 Query: 247 DPDSDPHSVSQHLHLSFSHITPTPDLVLQTLNLSTEAGRSVLGFHQWLASNPKFTHTDDT 68 + DSDP SV++ LHLSFSHITPTP+++LQTL+LS EAGR VLGFHQWLASNPKFTHTD+T Sbjct: 86 ESDSDPSSVAERLHLSFSHITPTPNVILQTLDLSPEAGRIVLGFHQWLASNPKFTHTDET 145 Query: 67 LSYFVDYFGRRKDFKATHEVL 5 +SYFVDYFGRR DFKA +VL Sbjct: 146 VSYFVDYFGRRNDFKAMDKVL 166 >KHN04927.1 Pentatricopeptide repeat-containing protein, mitochondrial [Glycine soja] Length = 489 Score = 137 bits (344), Expect = 2e-36 Identities = 63/81 (77%), Positives = 72/81 (88%) Frame = -2 Query: 247 DPDSDPHSVSQHLHLSFSHITPTPDLVLQTLNLSTEAGRSVLGFHQWLASNPKFTHTDDT 68 +PDSD SVSQ LHLSFSHITPTP+L+LQTLNLS E+GR+VLGFHQWL+SNP+F+HTDDT Sbjct: 78 EPDSDALSVSQRLHLSFSHITPTPNLILQTLNLSHESGRTVLGFHQWLSSNPQFSHTDDT 137 Query: 67 LSYFVDYFGRRKDFKATHEVL 5 LSYF+DY G KDFKA H VL Sbjct: 138 LSYFIDYSGHYKDFKAMHNVL 158 >ONI08906.1 hypothetical protein PRUPE_5G207600 [Prunus persica] Length = 531 Score = 131 bits (329), Expect = 3e-34 Identities = 60/81 (74%), Positives = 69/81 (85%) Frame = -2 Query: 247 DPDSDPHSVSQHLHLSFSHITPTPDLVLQTLNLSTEAGRSVLGFHQWLASNPKFTHTDDT 68 DP SDP SV+Q L LSFSHITPTP LV LNLS +AGR+V+GF++WL SNP F HTD+T Sbjct: 97 DPSSDPLSVTQRLQLSFSHITPTPSLVQSVLNLSPDAGRAVIGFNEWLISNPTFEHTDET 156 Query: 67 LSYFVDYFGRRKDFKATHEVL 5 LSYFVDYFGRRKDFKATH+V+ Sbjct: 157 LSYFVDYFGRRKDFKATHDVI 177 >XP_008240094.1 PREDICTED: pentatricopeptide repeat-containing protein PNM1, mitochondrial [Prunus mume] Length = 531 Score = 131 bits (329), Expect = 3e-34 Identities = 60/81 (74%), Positives = 69/81 (85%) Frame = -2 Query: 247 DPDSDPHSVSQHLHLSFSHITPTPDLVLQTLNLSTEAGRSVLGFHQWLASNPKFTHTDDT 68 DP SDP SV+Q L LSFSHITPTP LV LNLS +AGR+V+GF++WL SNP F HTD+T Sbjct: 97 DPSSDPLSVTQRLQLSFSHITPTPSLVQSVLNLSPDAGRAVIGFNEWLISNPTFEHTDET 156 Query: 67 LSYFVDYFGRRKDFKATHEVL 5 LSYFVDYFGRRKDFKATH+V+ Sbjct: 157 LSYFVDYFGRRKDFKATHDVI 177 >XP_008453300.1 PREDICTED: pentatricopeptide repeat-containing protein PNM1, mitochondrial [Cucumis melo] Length = 522 Score = 130 bits (328), Expect = 4e-34 Identities = 59/82 (71%), Positives = 69/82 (84%) Frame = -2 Query: 247 DPDSDPHSVSQHLHLSFSHITPTPDLVLQTLNLSTEAGRSVLGFHQWLASNPKFTHTDDT 68 DPDSDP ++Q L LSFSH+ P P+LV TLNLS+EAGR+VLGF++WL SNP F HTD+T Sbjct: 89 DPDSDPLPITQRLQLSFSHVKPNPELVRNTLNLSSEAGRTVLGFNEWLVSNPDFHHTDET 148 Query: 67 LSYFVDYFGRRKDFKATHEVLA 2 +SYFVDYFGRRKDF A HEVLA Sbjct: 149 ISYFVDYFGRRKDFNAVHEVLA 170 >XP_019082040.1 PREDICTED: pentatricopeptide repeat-containing protein PNM1, mitochondrial [Vitis vinifera] CBI15328.3 unnamed protein product, partial [Vitis vinifera] Length = 532 Score = 130 bits (327), Expect = 7e-34 Identities = 58/81 (71%), Positives = 71/81 (87%) Frame = -2 Query: 247 DPDSDPHSVSQHLHLSFSHITPTPDLVLQTLNLSTEAGRSVLGFHQWLASNPKFTHTDDT 68 DPDS+P + Q L LSFSHITP+P L+LQTLN S +AGR+VLGF++WL+SNPKF H+D+T Sbjct: 100 DPDSEPVPIIQRLQLSFSHITPSPPLILQTLNTSPDAGRTVLGFYKWLSSNPKFVHSDET 159 Query: 67 LSYFVDYFGRRKDFKATHEVL 5 +S+FVDYFGRRKDFKA HEVL Sbjct: 160 ISFFVDYFGRRKDFKAIHEVL 180 >XP_009346139.1 PREDICTED: LOW QUALITY PROTEIN: pentatricopeptide repeat-containing protein PNM1, mitochondrial-like [Pyrus x bretschneideri] Length = 538 Score = 129 bits (323), Expect = 3e-33 Identities = 60/81 (74%), Positives = 67/81 (82%) Frame = -2 Query: 247 DPDSDPHSVSQHLHLSFSHITPTPDLVLQTLNLSTEAGRSVLGFHQWLASNPKFTHTDDT 68 DP SDP SV+Q L LSFSHITPTP LVL LN S EAGR+V+GF+QWL SN F HTD+T Sbjct: 97 DPSSDPLSVTQRLQLSFSHITPTPSLVLSVLNQSPEAGRTVIGFNQWLISNRNFEHTDET 156 Query: 67 LSYFVDYFGRRKDFKATHEVL 5 LSYFVDYFGRRKDFK TH+V+ Sbjct: 157 LSYFVDYFGRRKDFKVTHDVI 177 >XP_008393245.1 PREDICTED: pentatricopeptide repeat-containing protein PNM1, mitochondrial [Malus domestica] Length = 537 Score = 128 bits (321), Expect = 5e-33 Identities = 61/81 (75%), Positives = 67/81 (82%) Frame = -2 Query: 247 DPDSDPHSVSQHLHLSFSHITPTPDLVLQTLNLSTEAGRSVLGFHQWLASNPKFTHTDDT 68 D SDP SV+Q L LSFSHITPT LVL LN S EAGR+VLGF+QWL SNP F HTD+T Sbjct: 97 DSSSDPLSVTQRLQLSFSHITPTAPLVLNVLNQSPEAGRTVLGFNQWLISNPNFEHTDET 156 Query: 67 LSYFVDYFGRRKDFKATHEVL 5 LSYFVDYFGRRKDFKATH+V+ Sbjct: 157 LSYFVDYFGRRKDFKATHDVI 177 >XP_015943692.1 PREDICTED: pentatricopeptide repeat-containing protein PNM1, mitochondrial [Arachis duranensis] Length = 533 Score = 127 bits (319), Expect = 9e-33 Identities = 61/83 (73%), Positives = 71/83 (85%), Gaps = 1/83 (1%) Frame = -2 Query: 247 DPDSDPHSVSQHLHLSFSHITPTPDLVLQTLNLSTEAGRS-VLGFHQWLASNPKFTHTDD 71 DPDSDP S SQ L LSFSHITPT +LVLQ LN+S EA R+ VLGFH+WL SNPKF HTD+ Sbjct: 89 DPDSDPLSFSQRLQLSFSHITPTGNLVLQILNISPEASRATVLGFHRWLISNPKFDHTDE 148 Query: 70 TLSYFVDYFGRRKDFKATHEVLA 2 T+SYFVD+ GR+KDFKATH+VL+ Sbjct: 149 TVSYFVDFLGRKKDFKATHDVLS 171