BLASTX nr result
ID: Glycyrrhiza36_contig00007265
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza36_contig00007265 (370 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_014624599.1 PREDICTED: F-box protein At4g00755-like isoform X... 71 3e-12 XP_003549121.1 PREDICTED: F-box protein At4g00755-like isoform X... 71 4e-12 KYP61965.1 hypothetical protein KK1_016480 [Cajanus cajan] 66 4e-12 KHN31531.1 F-box protein [Glycine soja] 71 5e-12 XP_003534016.1 PREDICTED: F-box protein At4g00755-like [Glycine ... 70 1e-11 XP_019413952.1 PREDICTED: F-box protein At4g00755-like [Lupinus ... 65 6e-10 XP_017440245.1 PREDICTED: F-box protein At4g00755-like isoform X... 65 8e-10 XP_017440244.1 PREDICTED: F-box protein At4g00755-like isoform X... 65 9e-10 XP_014515426.1 PREDICTED: F-box protein At4g00755-like [Vigna ra... 65 9e-10 GAU40163.1 hypothetical protein TSUD_292680 [Trifolium subterran... 64 1e-09 XP_007152334.1 hypothetical protein PHAVU_004G121200g [Phaseolus... 59 7e-08 XP_016204195.1 PREDICTED: F-box protein At4g00755-like [Arachis ... 58 2e-07 KOM54952.1 hypothetical protein LR48_Vigan10g084400 [Vigna angul... 57 3e-07 XP_013443174.1 F-box-like protein [Medicago truncatula] KEH17199... 53 6e-07 >XP_014624599.1 PREDICTED: F-box protein At4g00755-like isoform X2 [Glycine max] Length = 307 Score = 71.2 bits (173), Expect = 3e-12 Identities = 32/35 (91%), Positives = 35/35 (100%) Frame = +3 Query: 264 MSDVRNKMDFIQLLGPDMSIKILTHLDDPCDLVRV 368 MS+VRNK+DFIQLLGPDMSIKILTHLDDPCDL+RV Sbjct: 1 MSEVRNKVDFIQLLGPDMSIKILTHLDDPCDLIRV 35 >XP_003549121.1 PREDICTED: F-box protein At4g00755-like isoform X1 [Glycine max] XP_006599630.1 PREDICTED: F-box protein At4g00755-like isoform X1 [Glycine max] KRH09124.1 hypothetical protein GLYMA_16G197900 [Glycine max] KRH09125.1 hypothetical protein GLYMA_16G197900 [Glycine max] KRH09126.1 hypothetical protein GLYMA_16G197900 [Glycine max] KRH09127.1 hypothetical protein GLYMA_16G197900 [Glycine max] KRH09128.1 hypothetical protein GLYMA_16G197900 [Glycine max] Length = 372 Score = 71.2 bits (173), Expect = 4e-12 Identities = 32/35 (91%), Positives = 35/35 (100%) Frame = +3 Query: 264 MSDVRNKMDFIQLLGPDMSIKILTHLDDPCDLVRV 368 MS+VRNK+DFIQLLGPDMSIKILTHLDDPCDL+RV Sbjct: 1 MSEVRNKVDFIQLLGPDMSIKILTHLDDPCDLIRV 35 >KYP61965.1 hypothetical protein KK1_016480 [Cajanus cajan] Length = 74 Score = 66.2 bits (160), Expect = 4e-12 Identities = 31/35 (88%), Positives = 32/35 (91%) Frame = +3 Query: 264 MSDVRNKMDFIQLLGPDMSIKILTHLDDPCDLVRV 368 MS V NKMDFIQLLGPDMSIKILTHLDDPCDL+ V Sbjct: 1 MSKVTNKMDFIQLLGPDMSIKILTHLDDPCDLIWV 35 >KHN31531.1 F-box protein [Glycine soja] Length = 493 Score = 71.2 bits (173), Expect = 5e-12 Identities = 32/35 (91%), Positives = 35/35 (100%) Frame = +3 Query: 264 MSDVRNKMDFIQLLGPDMSIKILTHLDDPCDLVRV 368 MS+VRNK+DFIQLLGPDMSIKILTHLDDPCDL+RV Sbjct: 1 MSEVRNKVDFIQLLGPDMSIKILTHLDDPCDLIRV 35 >XP_003534016.1 PREDICTED: F-box protein At4g00755-like [Glycine max] XP_006587356.1 PREDICTED: F-box protein At4g00755-like [Glycine max] XP_006587357.1 PREDICTED: F-box protein At4g00755-like [Glycine max] KHN25174.1 F-box protein [Glycine soja] KRH38595.1 hypothetical protein GLYMA_09G145800 [Glycine max] KRH38596.1 hypothetical protein GLYMA_09G145800 [Glycine max] KRH38597.1 hypothetical protein GLYMA_09G145800 [Glycine max] KRH38598.1 hypothetical protein GLYMA_09G145800 [Glycine max] KRH38599.1 hypothetical protein GLYMA_09G145800 [Glycine max] KRH38600.1 hypothetical protein GLYMA_09G145800 [Glycine max] Length = 374 Score = 70.1 bits (170), Expect = 1e-11 Identities = 31/35 (88%), Positives = 35/35 (100%) Frame = +3 Query: 264 MSDVRNKMDFIQLLGPDMSIKILTHLDDPCDLVRV 368 MS+V+NK+DFIQLLGPDMSIKILTHLDDPCDL+RV Sbjct: 1 MSEVKNKVDFIQLLGPDMSIKILTHLDDPCDLIRV 35 >XP_019413952.1 PREDICTED: F-box protein At4g00755-like [Lupinus angustifolius] OIV98921.1 hypothetical protein TanjilG_07356 [Lupinus angustifolius] Length = 363 Score = 65.1 bits (157), Expect = 6e-10 Identities = 29/35 (82%), Positives = 32/35 (91%) Frame = +3 Query: 264 MSDVRNKMDFIQLLGPDMSIKILTHLDDPCDLVRV 368 MS+V+NK+DFIQ LGPDMSIKILTHLDDPCDL V Sbjct: 1 MSEVKNKLDFIQWLGPDMSIKILTHLDDPCDLAHV 35 >XP_017440245.1 PREDICTED: F-box protein At4g00755-like isoform X2 [Vigna angularis] Length = 341 Score = 64.7 bits (156), Expect = 8e-10 Identities = 28/35 (80%), Positives = 33/35 (94%) Frame = +3 Query: 264 MSDVRNKMDFIQLLGPDMSIKILTHLDDPCDLVRV 368 M++ +NKMDFIQLLGPDMS+KILTHLD PCDL+RV Sbjct: 1 MTEEKNKMDFIQLLGPDMSVKILTHLDAPCDLIRV 35 >XP_017440244.1 PREDICTED: F-box protein At4g00755-like isoform X1 [Vigna angularis] BAU02399.1 hypothetical protein VIGAN_11192000 [Vigna angularis var. angularis] Length = 367 Score = 64.7 bits (156), Expect = 9e-10 Identities = 28/35 (80%), Positives = 33/35 (94%) Frame = +3 Query: 264 MSDVRNKMDFIQLLGPDMSIKILTHLDDPCDLVRV 368 M++ +NKMDFIQLLGPDMS+KILTHLD PCDL+RV Sbjct: 1 MTEEKNKMDFIQLLGPDMSVKILTHLDAPCDLIRV 35 >XP_014515426.1 PREDICTED: F-box protein At4g00755-like [Vigna radiata var. radiata] Length = 368 Score = 64.7 bits (156), Expect = 9e-10 Identities = 28/35 (80%), Positives = 33/35 (94%) Frame = +3 Query: 264 MSDVRNKMDFIQLLGPDMSIKILTHLDDPCDLVRV 368 M++ +NKMDFIQLLGPDMS+KILTHLD PCDL+RV Sbjct: 1 MTEEKNKMDFIQLLGPDMSVKILTHLDAPCDLIRV 35 >GAU40163.1 hypothetical protein TSUD_292680 [Trifolium subterraneum] Length = 226 Score = 63.5 bits (153), Expect = 1e-09 Identities = 29/40 (72%), Positives = 35/40 (87%) Frame = +3 Query: 249 VILGNMSDVRNKMDFIQLLGPDMSIKILTHLDDPCDLVRV 368 +I G MS+V+ KMDFIQ LG DMSIK+L++LDDPCDLVRV Sbjct: 1 MIFGKMSEVKTKMDFIQWLGLDMSIKVLSYLDDPCDLVRV 40 >XP_007152334.1 hypothetical protein PHAVU_004G121200g [Phaseolus vulgaris] ESW24328.1 hypothetical protein PHAVU_004G121200g [Phaseolus vulgaris] Length = 368 Score = 59.3 bits (142), Expect = 7e-08 Identities = 27/35 (77%), Positives = 32/35 (91%) Frame = +3 Query: 264 MSDVRNKMDFIQLLGPDMSIKILTHLDDPCDLVRV 368 MS+ +NK+DFIQLLGPD+SIKILTHLD P DL+RV Sbjct: 1 MSEEKNKVDFIQLLGPDVSIKILTHLDAPSDLIRV 35 >XP_016204195.1 PREDICTED: F-box protein At4g00755-like [Arachis ipaensis] Length = 365 Score = 58.2 bits (139), Expect = 2e-07 Identities = 27/35 (77%), Positives = 32/35 (91%) Frame = +3 Query: 264 MSDVRNKMDFIQLLGPDMSIKILTHLDDPCDLVRV 368 MS+V+NK+D +Q LGPDMSIK+LTHL DPCDLVRV Sbjct: 1 MSEVKNKLDLLQWLGPDMSIKVLTHL-DPCDLVRV 34 >KOM54952.1 hypothetical protein LR48_Vigan10g084400 [Vigna angularis] Length = 360 Score = 57.4 bits (137), Expect = 3e-07 Identities = 25/28 (89%), Positives = 27/28 (96%) Frame = +3 Query: 285 MDFIQLLGPDMSIKILTHLDDPCDLVRV 368 MDFIQLLGPDMS+KILTHLD PCDL+RV Sbjct: 1 MDFIQLLGPDMSVKILTHLDAPCDLIRV 28 >XP_013443174.1 F-box-like protein [Medicago truncatula] KEH17199.1 F-box-like protein [Medicago truncatula] Length = 78 Score = 53.1 bits (126), Expect = 6e-07 Identities = 25/29 (86%), Positives = 26/29 (89%) Frame = +3 Query: 282 KMDFIQLLGPDMSIKILTHLDDPCDLVRV 368 KMDFIQ LGPD+SIKILT LDD CDLVRV Sbjct: 14 KMDFIQCLGPDLSIKILTSLDDRCDLVRV 42