BLASTX nr result
ID: Glycyrrhiza36_contig00007053
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza36_contig00007053 (223 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AFK36040.1 unknown [Lotus japonicus] 57 1e-07 XP_007139204.1 hypothetical protein PHAVU_008G010000g [Phaseolus... 56 2e-07 XP_003552706.1 PREDICTED: ATP-dependent Clp protease proteolytic... 56 2e-07 ACU19554.1 unknown [Glycine max] 56 2e-07 ACU22868.1 unknown, partial [Glycine max] 55 3e-07 XP_003518640.1 PREDICTED: ATP-dependent Clp protease proteolytic... 55 3e-07 KYP64989.1 hypothetical protein KK1_019603 [Cajanus cajan] 54 1e-06 >AFK36040.1 unknown [Lotus japonicus] Length = 324 Score = 56.6 bits (135), Expect = 1e-07 Identities = 32/51 (62%), Positives = 36/51 (70%), Gaps = 5/51 (9%) Frame = +1 Query: 22 MEVSLASTTCMPLSFKSKLKHSLPHTQIPILTED-----RRRTKPVFIINA 159 ME+SLAST CMPLSFK KL H L H+QIPILT R TKP+F +NA Sbjct: 1 MELSLAST-CMPLSFKLKLNHDLFHSQIPILTASTKATRRTTTKPLFTVNA 50 >XP_007139204.1 hypothetical protein PHAVU_008G010000g [Phaseolus vulgaris] ESW11198.1 hypothetical protein PHAVU_008G010000g [Phaseolus vulgaris] Length = 309 Score = 56.2 bits (134), Expect = 2e-07 Identities = 29/48 (60%), Positives = 36/48 (75%), Gaps = 2/48 (4%) Frame = +1 Query: 22 MEVSLASTTCMPLSFKSKLKHSLPHTQIPILTED--RRRTKPVFIINA 159 MEVSL+ST+C+PLS K K KH+L H+Q P T RRTKP+FI+NA Sbjct: 1 MEVSLSSTSCIPLSAKLKHKHALFHSQFPTSTASTKTRRTKPLFIVNA 48 >XP_003552706.1 PREDICTED: ATP-dependent Clp protease proteolytic subunit 3, chloroplastic-like [Glycine max] KHN13915.1 ATP-dependent Clp protease proteolytic subunit 3, chloroplastic [Glycine soja] KRH01676.1 hypothetical protein GLYMA_18G291900 [Glycine max] Length = 322 Score = 55.8 bits (133), Expect = 2e-07 Identities = 30/48 (62%), Positives = 36/48 (75%), Gaps = 2/48 (4%) Frame = +1 Query: 22 MEVSLASTTCMPLSFKSKLKHSLPHTQIPILTED--RRRTKPVFIINA 159 MEVSL+ST+C+PLS K K KH L H+QIPI T RRTKP+ I+NA Sbjct: 1 MEVSLSSTSCIPLSSKLKHKHGLFHSQIPIPTASTKTRRTKPLSIVNA 48 >ACU19554.1 unknown [Glycine max] Length = 322 Score = 55.8 bits (133), Expect = 2e-07 Identities = 30/48 (62%), Positives = 36/48 (75%), Gaps = 2/48 (4%) Frame = +1 Query: 22 MEVSLASTTCMPLSFKSKLKHSLPHTQIPILTED--RRRTKPVFIINA 159 MEVSL+ST+C+PLS K K KH L H+QIPI T RRTKP+ I+NA Sbjct: 1 MEVSLSSTSCIPLSSKLKHKHGLFHSQIPIPTASTKTRRTKPLSIVNA 48 >ACU22868.1 unknown, partial [Glycine max] Length = 270 Score = 55.5 bits (132), Expect = 3e-07 Identities = 29/48 (60%), Positives = 36/48 (75%), Gaps = 2/48 (4%) Frame = +1 Query: 22 MEVSLASTTCMPLSFKSKLKHSLPHTQIPILTED--RRRTKPVFIINA 159 MEVSL+ST+C+PLS K K KH L H+QIPI T RRTKP+ ++NA Sbjct: 1 MEVSLSSTSCIPLSSKLKHKHGLFHSQIPIHTASTKTRRTKPLSVVNA 48 >XP_003518640.1 PREDICTED: ATP-dependent Clp protease proteolytic subunit 3, chloroplastic [Glycine max] KHN47255.1 ATP-dependent Clp protease proteolytic subunit 3, chloroplastic [Glycine soja] KRH70450.1 hypothetical protein GLYMA_02G091200 [Glycine max] Length = 319 Score = 55.5 bits (132), Expect = 3e-07 Identities = 29/48 (60%), Positives = 36/48 (75%), Gaps = 2/48 (4%) Frame = +1 Query: 22 MEVSLASTTCMPLSFKSKLKHSLPHTQIPILTED--RRRTKPVFIINA 159 MEVSL+ST+C+PLS K K KH L H+QIPI T RRTKP+ ++NA Sbjct: 1 MEVSLSSTSCIPLSSKLKHKHGLFHSQIPIHTASTKTRRTKPLSVVNA 48 >KYP64989.1 hypothetical protein KK1_019603 [Cajanus cajan] Length = 317 Score = 53.5 bits (127), Expect = 1e-06 Identities = 26/48 (54%), Positives = 36/48 (75%), Gaps = 2/48 (4%) Frame = +1 Query: 22 MEVSLASTTCMPLSFKSKLKHSLPHTQIPILTEDRR--RTKPVFIINA 159 MEVSL+ST+C+P++ K KL H L H+Q PI T + +TKP+FI+NA Sbjct: 1 MEVSLSSTSCIPINSKLKLSHPLFHSQFPIHTASTKTTKTKPLFIVNA 48