BLASTX nr result
ID: Glycyrrhiza36_contig00001313
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza36_contig00001313 (248 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value KYP40169.1 hypothetical protein KK1_038503 [Cajanus cajan] 56 2e-07 XP_003533369.2 PREDICTED: aluminum-activated malate transporter ... 55 8e-07 >KYP40169.1 hypothetical protein KK1_038503 [Cajanus cajan] Length = 594 Score = 56.2 bits (134), Expect = 2e-07 Identities = 24/33 (72%), Positives = 28/33 (84%) Frame = +2 Query: 140 PESNEEDHYPLQWRRCCSFRAFSDGIVGAWETS 238 PES E+D P + RRCCS+RAFSDGIVGAW+TS Sbjct: 40 PESEEDDPSPRRRRRCCSYRAFSDGIVGAWQTS 72 >XP_003533369.2 PREDICTED: aluminum-activated malate transporter 9-like [Glycine max] KRH39212.1 hypothetical protein GLYMA_09G185600 [Glycine max] Length = 598 Score = 54.7 bits (130), Expect = 8e-07 Identities = 24/35 (68%), Positives = 30/35 (85%) Frame = +2 Query: 134 PQPESNEEDHYPLQWRRCCSFRAFSDGIVGAWETS 238 P PES+EEDH P + RRCCS+RA SDGIVGAW+++ Sbjct: 43 PLPESDEEDHSPTR-RRCCSYRAVSDGIVGAWKSA 76