BLASTX nr result
ID: Glycyrrhiza36_contig00000644
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza36_contig00000644 (238 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_003614649.1 cytochrome P450 family protein [Medicago truncatu... 59 3e-08 GAU48645.1 hypothetical protein TSUD_405920 [Trifolium subterran... 59 3e-08 BAA84916.1 cytochrome P450, partial [Cicer arietinum] 57 1e-07 XP_004514899.1 PREDICTED: geraniol 8-hydroxylase-like [Cicer ari... 57 1e-07 >XP_003614649.1 cytochrome P450 family protein [Medicago truncatula] AES97607.1 cytochrome P450 family protein [Medicago truncatula] Length = 425 Score = 58.5 bits (140), Expect = 3e-08 Identities = 26/28 (92%), Positives = 28/28 (100%) Frame = -3 Query: 215 LKPEEMDMSHMFGVTLHKAQPLRVVPIK 132 LKP++MDMSHMFGVTLHKAQPLRVVPIK Sbjct: 397 LKPDDMDMSHMFGVTLHKAQPLRVVPIK 424 >GAU48645.1 hypothetical protein TSUD_405920 [Trifolium subterraneum] Length = 507 Score = 58.5 bits (140), Expect = 3e-08 Identities = 26/28 (92%), Positives = 28/28 (100%) Frame = -3 Query: 215 LKPEEMDMSHMFGVTLHKAQPLRVVPIK 132 LKP++MDMSHMFGVTLHKAQPLRVVPIK Sbjct: 479 LKPDDMDMSHMFGVTLHKAQPLRVVPIK 506 >BAA84916.1 cytochrome P450, partial [Cicer arietinum] Length = 381 Score = 57.0 bits (136), Expect = 1e-07 Identities = 27/35 (77%), Positives = 29/35 (82%) Frame = -3 Query: 236 NGSLLMGLKPEEMDMSHMFGVTLHKAQPLRVVPIK 132 N L LKP++MDMSH FGVTLHKAQPLRVVPIK Sbjct: 346 NFKLADDLKPDDMDMSHKFGVTLHKAQPLRVVPIK 380 >XP_004514899.1 PREDICTED: geraniol 8-hydroxylase-like [Cicer arietinum] Length = 507 Score = 57.0 bits (136), Expect = 1e-07 Identities = 27/35 (77%), Positives = 29/35 (82%) Frame = -3 Query: 236 NGSLLMGLKPEEMDMSHMFGVTLHKAQPLRVVPIK 132 N L LKP++MDMSH FGVTLHKAQPLRVVPIK Sbjct: 472 NFKLADDLKPDDMDMSHKFGVTLHKAQPLRVVPIK 506