BLASTX nr result
ID: Glycyrrhiza35_contig00022918
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza35_contig00022918 (281 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value YP_007516853.1 hypothetical protein GlmaxMp03 (mitochondrion) [G... 137 8e-40 EYU25691.1 hypothetical protein MIMGU_mgv1a018587mg, partial [Er... 94 4e-23 KJB09734.1 hypothetical protein B456_001G161000, partial [Gossyp... 91 2e-20 GAU48497.1 hypothetical protein TSUD_291830 [Trifolium subterran... 80 1e-15 YP_173477.1 hypothetical protein NitaMp140 [Nicotiana tabacum] B... 74 3e-15 NP_064104.1 orf110b gene product (mitochondrion) [Beta vulgaris ... 56 3e-08 OMP10460.1 hypothetical protein COLO4_04489 [Corchorus olitorius... 50 1e-06 >YP_007516853.1 hypothetical protein GlmaxMp03 (mitochondrion) [Glycine max] AFR34334.1 hypothetical protein GlmaxMp03 (mitochondrion) [Glycine max] Length = 150 Score = 137 bits (346), Expect = 8e-40 Identities = 71/77 (92%), Positives = 71/77 (92%) Frame = +1 Query: 1 DQTALHLVSPPSAYRSTRSMNTRTELAHPFGHRDARTNPSNQPLFLENLPPARQDRATPK 180 DQTALHLVSPPSAYRSTRSM TRTELAHPFGHRDARTNPSNQPLFLENLPP DRATPK Sbjct: 78 DQTALHLVSPPSAYRSTRSMKTRTELAHPFGHRDARTNPSNQPLFLENLPP---DRATPK 134 Query: 181 SRIVQERSHFFFASSLT 231 SRIVQERSH FFASS T Sbjct: 135 SRIVQERSH-FFASSFT 150 >EYU25691.1 hypothetical protein MIMGU_mgv1a018587mg, partial [Erythranthe guttata] Length = 90 Score = 93.6 bits (231), Expect = 4e-23 Identities = 43/59 (72%), Positives = 49/59 (83%) Frame = +1 Query: 31 PSAYRSTRSMNTRTELAHPFGHRDARTNPSNQPLFLENLPPARQDRATPKSRIVQERSH 207 P AYR TRSM T+TELAHPFGHRDARTNP+NQP FL NLPPARQDR TP++ V+ S+ Sbjct: 15 PGAYRFTRSMKTQTELAHPFGHRDARTNPNNQPFFLSNLPPARQDRGTPEASRVRGGSN 73 >KJB09734.1 hypothetical protein B456_001G161000, partial [Gossypium raimondii] Length = 244 Score = 90.9 bits (224), Expect = 2e-20 Identities = 42/45 (93%), Positives = 42/45 (93%) Frame = +1 Query: 1 DQTALHLVSPPSAYRSTRSMNTRTELAHPFGHRDARTNPSNQPLF 135 DQTALHLVSPP AYRS RSMNTRTELAHPFGHR ARTNPSNQPLF Sbjct: 21 DQTALHLVSPPEAYRSARSMNTRTELAHPFGHRGARTNPSNQPLF 65 >GAU48497.1 hypothetical protein TSUD_291830 [Trifolium subterraneum] Length = 481 Score = 80.5 bits (197), Expect = 1e-15 Identities = 45/69 (65%), Positives = 46/69 (66%), Gaps = 2/69 (2%) Frame = -1 Query: 230 VKEEAKKKCERSCTIRLFGVA--LSCLAGGRFXXXXXXXXXXXXXXLCPKGWASSVRVFI 57 +KEEAK KCERSCTIRLFGVA LSCLAG KGWASSVRVFI Sbjct: 29 IKEEAKIKCERSCTIRLFGVALSLSCLAGVEADFLKKRLIRFSRPYAQKKGWASSVRVFI 88 Query: 56 DRVDLYAEG 30 DRVDLYAEG Sbjct: 89 DRVDLYAEG 97 >YP_173477.1 hypothetical protein NitaMp140 [Nicotiana tabacum] BAD83543.1 hypothetical protein (mitochondrion) [Nicotiana tabacum] Length = 116 Score = 74.3 bits (181), Expect = 3e-15 Identities = 44/75 (58%), Positives = 50/75 (66%), Gaps = 3/75 (4%) Frame = +1 Query: 58 MNTRTELAHPFGHRDARTNPSNQPLFLENL---PPARQDRATPKSRIVQERSHFFFASSL 228 MNT+TELAHPFGHRDARTNPSNQPLF E+ PP Q RIVQERSH F A S Sbjct: 1 MNTQTELAHPFGHRDARTNPSNQPLFFESASSKPP--QPYRQKAVRIVQERSH-FIAYSF 57 Query: 229 T*I*ENPARLPVLWT 273 T I ++ + +WT Sbjct: 58 TFISKSGSLPATVWT 72 >NP_064104.1 orf110b gene product (mitochondrion) [Beta vulgaris subsp. vulgaris] YP_004222346.1 hypothetical protein BevumaM_p112 (mitochondrion) [Beta vulgaris subsp. maritima] YP_004842151.1 hypothetical protein BemaM_p107 (mitochondrion) [Beta macrocarpa] BAA99498.1 orf110b (mitochondrion) [Beta vulgaris subsp. vulgaris] CBJ14076.1 hypothetical protein (mitochondrion) [Beta vulgaris subsp. maritima] CBJ17566.1 hypothetical protein (mitochondrion) [Beta vulgaris subsp. maritima] CBJ20714.1 hypothetical protein (mitochondrion) [Beta vulgaris subsp. maritima] CBX24956.1 hypothetical protein (mitochondrion) [Beta macrocarpa] CBL51962.1 hypothetical protein (mitochondrion) [Beta vulgaris subsp. maritima] Length = 110 Score = 56.2 bits (134), Expect = 3e-08 Identities = 26/30 (86%), Positives = 27/30 (90%) Frame = +1 Query: 1 DQTALHLVSPPSAYRSTRSMNTRTELAHPF 90 DQTALHLVSP AYRSTRS+ TRTELAHPF Sbjct: 11 DQTALHLVSPSEAYRSTRSIKTRTELAHPF 40 >OMP10460.1 hypothetical protein COLO4_04489 [Corchorus olitorius] OMP10520.1 hypothetical protein COLO4_04462 [Corchorus olitorius] OMP10559.1 hypothetical protein COLO4_04436 [Corchorus olitorius] Length = 48 Score = 50.4 bits (119), Expect = 1e-06 Identities = 23/29 (79%), Positives = 25/29 (86%) Frame = +1 Query: 1 DQTALHLVSPPSAYRSTRSMNTRTELAHP 87 DQTALHLVSP AYRS RSM T++ELAHP Sbjct: 11 DQTALHLVSPSEAYRSARSMKTQSELAHP 39