BLASTX nr result
ID: Glycyrrhiza35_contig00022697
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza35_contig00022697 (614 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value KRH37229.1 hypothetical protein GLYMA_09G053100 [Glycine max] 57 6e-08 >KRH37229.1 hypothetical protein GLYMA_09G053100 [Glycine max] Length = 46 Score = 57.0 bits (136), Expect = 6e-08 Identities = 27/42 (64%), Positives = 30/42 (71%) Frame = +2 Query: 92 NTAKVLCPTRPPPPQSNNGSTSNSEDKKPPPSTKDISYPKNR 217 N K LCPT+PPP + GSTS+S K PPSTKDI YPKNR Sbjct: 7 NIQKALCPTKPPP--KSTGSTSSSSGGKKPPSTKDIFYPKNR 46