BLASTX nr result
ID: Glycyrrhiza35_contig00022672
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza35_contig00022672 (428 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AFD53814.1 hypothetical protein, partial [Trichoderma harzianum] 48 4e-07 >AFD53814.1 hypothetical protein, partial [Trichoderma harzianum] Length = 108 Score = 47.8 bits (112), Expect(2) = 4e-07 Identities = 24/41 (58%), Positives = 28/41 (68%) Frame = +3 Query: 3 GIKTSHHDLNIVGYRRATYICTKGGESANFS*SLKQSKKWT 125 G KTSHH LNIVGYRRATY TK ++ N S S K K++ Sbjct: 39 GTKTSHHGLNIVGYRRATYAWTKRCKNVNLSLSQKTGYKFS 79 Score = 33.5 bits (75), Expect(2) = 4e-07 Identities = 17/28 (60%), Positives = 20/28 (71%) Frame = +1 Query: 118 NGLLSVTRLHK*GITSNRESPHHGEFNL 201 +GL S RL++ ITSNRESP HGE L Sbjct: 79 SGLWSEIRLYESVITSNRESPCHGELTL 106