BLASTX nr result
ID: Glycyrrhiza35_contig00004582
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza35_contig00004582 (576 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_003620942.1 photosystem I assembly protein ycf3 [Medicago tru... 103 8e-26 XP_003599571.2 photosystem I assembly protein ycf3 [Medicago tru... 103 8e-26 AMC32740.1 photosystem I assembly protein Ycf3 (chloroplast) [Vi... 103 1e-24 AJE71616.1 photosystem I assembly protein Ycf3 (plastid) [Melilo... 103 1e-24 YP_009141335.1 hypothetical chloroplast RF34 (chloroplast) [Lath... 103 1e-24 AHY33048.1 hypothetical chloroplast RF34 (chloroplast) [Indigofe... 103 1e-24 YP_003587531.1 photosystem I assembly protein Ycf3 [Pisum sativu... 103 1e-24 YP_002149724.1 hypothetical chloroplast RF34 [Cicer arietinum] A... 103 1e-24 YP_009141527.1 hypothetical chloroplast RF34 (chloroplast) [Lens... 103 1e-24 YP_009027263.1 hypothetical chloroplast RF34 (chloroplast) [Glyc... 103 1e-24 YP_009327957.1 photosystem I assembly protein Ycf3 (chloroplast)... 103 1e-24 AAZ03963.1 Ycf3, partial (chloroplast) [Nuphar advena] 101 3e-24 AHY32717.1 hypothetical chloroplast RF34 (chloroplast) [Arachis ... 102 3e-24 CUR08434.1 ycf3 (chloroplast) [Pararchidendron pruinosum] 102 3e-24 CUR04437.1 ycf3 (chloroplast) [Acacia longispinea] 102 3e-24 CUR02802.1 ycf3 (chloroplast) [Acacia gibbosa] 102 3e-24 CUR01345.1 ycf3 (chloroplast) [Acacia cerastes] 102 3e-24 YP_009171600.1 hypothetical chloroplast RF34 (chloroplast) [Elae... 102 3e-24 YP_009253564.1 Ycf3 (chloroplast) [Senna tora] AHY32810.1 hypoth... 102 3e-24 YP_009115416.1 photosystem I assembly protein (chloroplast) [Aca... 102 3e-24 >XP_003620942.1 photosystem I assembly protein ycf3 [Medicago truncatula] AES77160.1 photosystem I assembly protein ycf3 [Medicago truncatula] Length = 70 Score = 103 bits (257), Expect = 8e-26 Identities = 48/48 (100%), Positives = 48/48 (100%) Frame = -3 Query: 574 RGEQAIRQGDSEIAESWFDQAAEYWKQAIALTPGNYIEAQNWLKITGR 431 RGEQAIRQGDSEIAESWFDQAAEYWKQAIALTPGNYIEAQNWLKITGR Sbjct: 21 RGEQAIRQGDSEIAESWFDQAAEYWKQAIALTPGNYIEAQNWLKITGR 68 >XP_003599571.2 photosystem I assembly protein ycf3 [Medicago truncatula] AES69822.2 photosystem I assembly protein ycf3 [Medicago truncatula] Length = 70 Score = 103 bits (257), Expect = 8e-26 Identities = 48/48 (100%), Positives = 48/48 (100%) Frame = -3 Query: 574 RGEQAIRQGDSEIAESWFDQAAEYWKQAIALTPGNYIEAQNWLKITGR 431 RGEQAIRQGDSEIAESWFDQAAEYWKQAIALTPGNYIEAQNWLKITGR Sbjct: 21 RGEQAIRQGDSEIAESWFDQAAEYWKQAIALTPGNYIEAQNWLKITGR 68 >AMC32740.1 photosystem I assembly protein Ycf3 (chloroplast) [Vicia villosa] Length = 168 Score = 103 bits (257), Expect = 1e-24 Identities = 48/48 (100%), Positives = 48/48 (100%) Frame = -3 Query: 574 RGEQAIRQGDSEIAESWFDQAAEYWKQAIALTPGNYIEAQNWLKITGR 431 RGEQAIRQGDSEIAESWFDQAAEYWKQAIALTPGNYIEAQNWLKITGR Sbjct: 119 RGEQAIRQGDSEIAESWFDQAAEYWKQAIALTPGNYIEAQNWLKITGR 166 >AJE71616.1 photosystem I assembly protein Ycf3 (plastid) [Melilotus officinalis] AJE71687.1 photosystem I assembly protein Ycf3 (plastid) [Melilotus albus] Length = 168 Score = 103 bits (257), Expect = 1e-24 Identities = 48/48 (100%), Positives = 48/48 (100%) Frame = -3 Query: 574 RGEQAIRQGDSEIAESWFDQAAEYWKQAIALTPGNYIEAQNWLKITGR 431 RGEQAIRQGDSEIAESWFDQAAEYWKQAIALTPGNYIEAQNWLKITGR Sbjct: 119 RGEQAIRQGDSEIAESWFDQAAEYWKQAIALTPGNYIEAQNWLKITGR 166 >YP_009141335.1 hypothetical chloroplast RF34 (chloroplast) [Lathyrus inconspicuus] AIL55861.1 hypothetical chloroplast RF34 (chloroplast) [Lathyrus inconspicuus] Length = 168 Score = 103 bits (257), Expect = 1e-24 Identities = 48/48 (100%), Positives = 48/48 (100%) Frame = -3 Query: 574 RGEQAIRQGDSEIAESWFDQAAEYWKQAIALTPGNYIEAQNWLKITGR 431 RGEQAIRQGDSEIAESWFDQAAEYWKQAIALTPGNYIEAQNWLKITGR Sbjct: 119 RGEQAIRQGDSEIAESWFDQAAEYWKQAIALTPGNYIEAQNWLKITGR 166 >AHY33048.1 hypothetical chloroplast RF34 (chloroplast) [Indigofera tinctoria] Length = 168 Score = 103 bits (257), Expect = 1e-24 Identities = 48/48 (100%), Positives = 48/48 (100%) Frame = -3 Query: 574 RGEQAIRQGDSEIAESWFDQAAEYWKQAIALTPGNYIEAQNWLKITGR 431 RGEQAIRQGDSEIAESWFDQAAEYWKQAIALTPGNYIEAQNWLKITGR Sbjct: 119 RGEQAIRQGDSEIAESWFDQAAEYWKQAIALTPGNYIEAQNWLKITGR 166 >YP_003587531.1 photosystem I assembly protein Ycf3 [Pisum sativum] YP_009027146.1 hypothetical chloroplast RF34 [Trifolium aureum] YP_009027070.1 hypothetical chloroplast RF34 [Trifolium grandiflorum] YP_009109809.1 hypothetical chloroplast RF34 (chloroplast) [Trifolium boissieri] YP_009138396.1 hypothetical chloroplast RF34 (chloroplast) [Lathyrus davidii] YP_009138477.1 hypothetical chloroplast RF34 (chloroplast) [Lathyrus graminifolius] YP_009138550.1 hypothetical chloroplast RF34 (chloroplast) [Lathyrus japonicus] YP_009138624.1 hypothetical chloroplast RF34 (chloroplast) [Lathyrus littoralis] YP_009138699.1 hypothetical chloroplast RF34 (chloroplast) [Lathyrus ochroleucus] YP_009138856.1 hypothetical chloroplast RF34 (chloroplast) [Lathyrus pubescens] YP_009138923.1 hypothetical chloroplast RF34 (chloroplast) [Lathyrus venosus] YP_009138776.1 hypothetical chloroplast RF34 (chloroplast) [Lathyrus palustris] YP_009141231.1 hypothetical chloroplast RF34 (chloroplast) [Lathyrus clymenum] YP_009141453.1 hypothetical chloroplast RF34 (chloroplast) [Lathyrus tingitanus] YP_009141601.1 hypothetical chloroplast RF34 (chloroplast) [Medicago hybrida] YP_009141676.1 hypothetical chloroplast RF34 (chloroplast) [Medicago papillosa] ADE43593.1 photosystem I assembly protein Ycf3 (chloroplast) [Pisum sativum] AFR59984.1 photosystem I assembly protein Ycf3 (plastid) [Medicago truncatula] AFR60060.1 photosystem I assembly protein Ycf3 (plastid) [Medicago truncatula] AFR60136.1 photosystem I assembly protein Ycf3 (plastid) [Medicago truncatula] AGO63724.1 hypothetical chloroplast RF34 (plastid) [Trifolium grandiflorum] AGO63800.1 hypothetical chloroplast RF34 (plastid) [Trifolium aureum] AGV52614.1 photosystem I assembly protein Ycf3 (chloroplast) [Medicago truncatula f. tricycla] AIJ27850.1 hypothetical chloroplast RF34 (chloroplast) [Trifolium boissieri] AIK20614.1 hypothetical chloroplast RF34 (chloroplast) [Lathyrus davidii] AIK20696.1 hypothetical chloroplast RF34 (chloroplast) [Lathyrus graminifolius] AIK20770.1 hypothetical chloroplast RF34 (chloroplast) [Lathyrus japonicus] AIK20844.1 hypothetical chloroplast RF34 (chloroplast) [Lathyrus japonicus] AIK20918.1 hypothetical chloroplast RF34 (chloroplast) [Lathyrus littoralis] AIK20993.1 hypothetical chloroplast RF34 (chloroplast) [Lathyrus ochroleucus] AIK21068.1 hypothetical chloroplast RF34 (chloroplast) [Lathyrus ochroleucus] AIK21145.1 hypothetical chloroplast RF34 (chloroplast) [Lathyrus palustris] AIK21224.1 hypothetical chloroplast RF34 (chloroplast) [Lathyrus pubescens] AIK21365.1 hypothetical chloroplast RF34 (chloroplast) [Lathyrus venosus] AIK21416.1 hypothetical chloroplast RF34 (chloroplast) [Pisum sativum] AIL55757.1 hypothetical chloroplast RF34 (chloroplast) [Lathyrus clymenum] AIL55979.1 hypothetical chloroplast RF34 (chloroplast) [Lathyrus tingitanus] AIL56126.1 hypothetical chloroplast RF34 (chloroplast) [Medicago hybrida] AIL56201.1 hypothetical chloroplast RF34 (chloroplast) [Medicago papillosa] AJE72183.1 photosystem I assembly protein Ycf3 (plastid) [Trifolium campestre] AJE72539.1 photosystem I assembly protein Ycf3 (plastid) [Medicago lupulina] AJE72893.1 photosystem I assembly protein Ycf3 (plastid) [Lathyrus decaphyllus] AMC32728.1 photosystem I assembly protein Ycf3 (chloroplast) [Medicago sativa] AMC32739.1 photosystem I assembly protein Ycf3 (chloroplast) [Vicia americana var. minor] ANS57896.1 hypothetical chloroplast RF34 (chloroplast) [Medicago sativa] Length = 168 Score = 103 bits (257), Expect = 1e-24 Identities = 48/48 (100%), Positives = 48/48 (100%) Frame = -3 Query: 574 RGEQAIRQGDSEIAESWFDQAAEYWKQAIALTPGNYIEAQNWLKITGR 431 RGEQAIRQGDSEIAESWFDQAAEYWKQAIALTPGNYIEAQNWLKITGR Sbjct: 119 RGEQAIRQGDSEIAESWFDQAAEYWKQAIALTPGNYIEAQNWLKITGR 166 >YP_002149724.1 hypothetical chloroplast RF34 [Cicer arietinum] ACH41061.1 hypothetical chloroplast RF34 (chloroplast) [Cicer arietinum] Length = 168 Score = 103 bits (257), Expect = 1e-24 Identities = 48/48 (100%), Positives = 48/48 (100%) Frame = -3 Query: 574 RGEQAIRQGDSEIAESWFDQAAEYWKQAIALTPGNYIEAQNWLKITGR 431 RGEQAIRQGDSEIAESWFDQAAEYWKQAIALTPGNYIEAQNWLKITGR Sbjct: 119 RGEQAIRQGDSEIAESWFDQAAEYWKQAIALTPGNYIEAQNWLKITGR 166 >YP_009141527.1 hypothetical chloroplast RF34 (chloroplast) [Lens culinaris] AGW45892.1 hypothetical chloroplast RF34 (plastid) [Lens culinaris] AIL56053.1 hypothetical chloroplast RF34 (chloroplast) [Lens culinaris] Length = 168 Score = 103 bits (257), Expect = 1e-24 Identities = 48/48 (100%), Positives = 48/48 (100%) Frame = -3 Query: 574 RGEQAIRQGDSEIAESWFDQAAEYWKQAIALTPGNYIEAQNWLKITGR 431 RGEQAIRQGDSEIAESWFDQAAEYWKQAIALTPGNYIEAQNWLKITGR Sbjct: 119 RGEQAIRQGDSEIAESWFDQAAEYWKQAIALTPGNYIEAQNWLKITGR 166 >YP_009027263.1 hypothetical chloroplast RF34 (chloroplast) [Glycyrrhiza glabra] YP_009161279.1 Ycf3 (chloroplast) [Wisteria floribunda] YP_009233384.1 Ycf3 (chloroplast) [Wisteria sinensis] YP_009334180.1 hypothetical chloroplast RF34 (chloroplast) [Caragana microphylla] AGU00059.1 hypothetical chloroplast RF34 (chloroplast) [Glycyrrhiza glabra] AJC10028.1 Ycf3 (chloroplast) [Wisteria floribunda] AMB27264.1 Ycf3 (chloroplast) [Wisteria sinensis] AMC32725.1 photosystem I assembly protein Ycf3 (chloroplast) [Glycyrrhiza lepidota] APL97386.1 hypothetical chloroplast RF34 (chloroplast) [Caragana microphylla] Length = 168 Score = 103 bits (257), Expect = 1e-24 Identities = 48/48 (100%), Positives = 48/48 (100%) Frame = -3 Query: 574 RGEQAIRQGDSEIAESWFDQAAEYWKQAIALTPGNYIEAQNWLKITGR 431 RGEQAIRQGDSEIAESWFDQAAEYWKQAIALTPGNYIEAQNWLKITGR Sbjct: 119 RGEQAIRQGDSEIAESWFDQAAEYWKQAIALTPGNYIEAQNWLKITGR 166 >YP_009327957.1 photosystem I assembly protein Ycf3 (chloroplast) [Medicago falcata] AOG66209.1 photosystem I assembly protein Ycf3 (chloroplast) [Medicago sativa] APC60501.1 photosystem I assembly protein Ycf3 (chloroplast) [Medicago falcata] Length = 169 Score = 103 bits (257), Expect = 1e-24 Identities = 48/48 (100%), Positives = 48/48 (100%) Frame = -3 Query: 574 RGEQAIRQGDSEIAESWFDQAAEYWKQAIALTPGNYIEAQNWLKITGR 431 RGEQAIRQGDSEIAESWFDQAAEYWKQAIALTPGNYIEAQNWLKITGR Sbjct: 120 RGEQAIRQGDSEIAESWFDQAAEYWKQAIALTPGNYIEAQNWLKITGR 167 >AAZ03963.1 Ycf3, partial (chloroplast) [Nuphar advena] Length = 126 Score = 101 bits (251), Expect = 3e-24 Identities = 46/48 (95%), Positives = 48/48 (100%) Frame = -3 Query: 574 RGEQAIRQGDSEIAESWFDQAAEYWKQAIALTPGNYIEAQNWLKITGR 431 RGE+AIRQGDSEIAE+WFDQAAEYWKQAIALTPGNYIEAQNWLKITGR Sbjct: 77 RGEEAIRQGDSEIAEAWFDQAAEYWKQAIALTPGNYIEAQNWLKITGR 124 >AHY32717.1 hypothetical chloroplast RF34 (chloroplast) [Arachis hypogaea] ANJ01504.1 hypothetical chloroplast RF34 (chloroplast) [Arachis hypogaea] Length = 167 Score = 102 bits (254), Expect = 3e-24 Identities = 47/48 (97%), Positives = 48/48 (100%) Frame = -3 Query: 574 RGEQAIRQGDSEIAESWFDQAAEYWKQAIALTPGNYIEAQNWLKITGR 431 RGEQAIRQGDSEIAE+WFDQAAEYWKQAIALTPGNYIEAQNWLKITGR Sbjct: 119 RGEQAIRQGDSEIAEAWFDQAAEYWKQAIALTPGNYIEAQNWLKITGR 166 >CUR08434.1 ycf3 (chloroplast) [Pararchidendron pruinosum] Length = 168 Score = 102 bits (254), Expect = 3e-24 Identities = 47/48 (97%), Positives = 48/48 (100%) Frame = -3 Query: 574 RGEQAIRQGDSEIAESWFDQAAEYWKQAIALTPGNYIEAQNWLKITGR 431 RGEQAIRQGDSEIAE+WFDQAAEYWKQAIALTPGNYIEAQNWLKITGR Sbjct: 119 RGEQAIRQGDSEIAEAWFDQAAEYWKQAIALTPGNYIEAQNWLKITGR 166 >CUR04437.1 ycf3 (chloroplast) [Acacia longispinea] Length = 168 Score = 102 bits (254), Expect = 3e-24 Identities = 47/48 (97%), Positives = 48/48 (100%) Frame = -3 Query: 574 RGEQAIRQGDSEIAESWFDQAAEYWKQAIALTPGNYIEAQNWLKITGR 431 RGEQAIRQGDSEIAE+WFDQAAEYWKQAIALTPGNYIEAQNWLKITGR Sbjct: 119 RGEQAIRQGDSEIAEAWFDQAAEYWKQAIALTPGNYIEAQNWLKITGR 166 >CUR02802.1 ycf3 (chloroplast) [Acacia gibbosa] Length = 168 Score = 102 bits (254), Expect = 3e-24 Identities = 47/48 (97%), Positives = 48/48 (100%) Frame = -3 Query: 574 RGEQAIRQGDSEIAESWFDQAAEYWKQAIALTPGNYIEAQNWLKITGR 431 RGEQAIRQGDSEIAE+WFDQAAEYWKQAIALTPGNYIEAQNWLKITGR Sbjct: 119 RGEQAIRQGDSEIAEAWFDQAAEYWKQAIALTPGNYIEAQNWLKITGR 166 >CUR01345.1 ycf3 (chloroplast) [Acacia cerastes] Length = 168 Score = 102 bits (254), Expect = 3e-24 Identities = 47/48 (97%), Positives = 48/48 (100%) Frame = -3 Query: 574 RGEQAIRQGDSEIAESWFDQAAEYWKQAIALTPGNYIEAQNWLKITGR 431 RGEQAIRQGDSEIAE+WFDQAAEYWKQAIALTPGNYIEAQNWLKITGR Sbjct: 119 RGEQAIRQGDSEIAEAWFDQAAEYWKQAIALTPGNYIEAQNWLKITGR 166 >YP_009171600.1 hypothetical chloroplast RF34 (chloroplast) [Elaeagnus macrophylla] AKE36497.1 hypothetical chloroplast RF34 (chloroplast) [Elaeagnus macrophylla] Length = 168 Score = 102 bits (254), Expect = 3e-24 Identities = 47/48 (97%), Positives = 48/48 (100%) Frame = -3 Query: 574 RGEQAIRQGDSEIAESWFDQAAEYWKQAIALTPGNYIEAQNWLKITGR 431 RGEQAIRQGDSEIAE+WFDQAAEYWKQAIALTPGNYIEAQNWLKITGR Sbjct: 119 RGEQAIRQGDSEIAEAWFDQAAEYWKQAIALTPGNYIEAQNWLKITGR 166 >YP_009253564.1 Ycf3 (chloroplast) [Senna tora] AHY32810.1 hypothetical chloroplast RF34 (chloroplast) [Libidibia coriaria] AHY32977.1 hypothetical chloroplast RF34 (chloroplast) [Haematoxylum brasiletto] AHY33308.1 hypothetical chloroplast RF34 (chloroplast) [Prosopis glandulosa] AJE71972.1 photosystem I assembly protein Ycf3 (plastid) [Baptisia bracteata] AJE72043.1 photosystem I assembly protein Ycf3 (plastid) [Chamaecrista fasciculata] AJE72398.1 photosystem I assembly protein Ycf3 (plastid) [Baptisia alba] ALF03753.1 Ycf3 (chloroplast) [Senna tora] AMC32717.1 photosystem I assembly protein Ycf3 (chloroplast) [Chamaecrista fasciculata] AMC32737.1 photosystem I assembly protein Ycf3 (chloroplast) [Senna marilandica] ANY60352.1 photosystem I assembly protein Ycf3 (chloroplast) [Mezoneuron cucullatum] Length = 168 Score = 102 bits (254), Expect = 3e-24 Identities = 47/48 (97%), Positives = 48/48 (100%) Frame = -3 Query: 574 RGEQAIRQGDSEIAESWFDQAAEYWKQAIALTPGNYIEAQNWLKITGR 431 RGEQAIRQGDSEIAE+WFDQAAEYWKQAIALTPGNYIEAQNWLKITGR Sbjct: 119 RGEQAIRQGDSEIAEAWFDQAAEYWKQAIALTPGNYIEAQNWLKITGR 166 >YP_009115416.1 photosystem I assembly protein (chloroplast) [Acacia ligulata] YP_009193075.1 photosystem I assembly protein Ycf3 (chloroplast) [Inga leiocalycina] YP_009193167.1 photosystem I assembly protein Ycf3 (chloroplast) [Leucaena trichandra] CED95162.1 Ycf3; photosystem I assembly protein (chloroplast) [Acacia ligulata] AJE72966.1 photosystem I assembly protein Ycf3 (plastid) [Desmanthus illinoensis] ALQ11462.1 photosystem I assembly protein Ycf3 (chloroplast) [Inga leiocalycina] ALQ11555.1 photosystem I assembly protein Ycf3 (chloroplast) [Leucaena trichandra] CUQ99989.1 ycf3 (chloroplast) [Acacia acanthoclada subsp. glaucescens] CUR00078.1 ycf3 (chloroplast) [Acacia acuaria] CUR00167.1 ycf3 (chloroplast) [Acacia acuminata] CUR00258.1 ycf3 (chloroplast) [Acacia acuminata] CUR00349.1 ycf3 (chloroplast) [Acacia ampliata] CUR00440.1 ycf3 (chloroplast) [Acacia andrewsii] CUR00531.1 ycf3 (chloroplast) [Acacia anthochaera] CUR00620.1 ycf3 (chloroplast) [Acacia anthochaera] CUR00709.1 ycf3 (chloroplast) [Acacia ashbyae] CUR00798.1 ycf3 (chloroplast) [Acacia assimilis subsp. assimilis] CUR00889.1 ycf3 (chloroplast) [Acacia assimilis subsp. assimilis] CUR00981.1 ycf3 (chloroplast) [Acacia aulacophylla] CUR01072.1 ycf3 (chloroplast) [Acacia blakelyi] CUR01163.1 ycf3 (chloroplast) [Acacia burkittii] CUR01254.1 ycf3 (chloroplast) [Acacia burkittii] CUR01436.1 ycf3 (chloroplast) [Acacia colletioides] CUR01528.1 ycf3 (chloroplast) [Acacia coolgardiensis] CUR01619.1 ycf3 (chloroplast) [Acacia cyclops] CUR01710.1 ycf3 (chloroplast) [Acacia daphnifolia] CUR01801.1 ycf3 (chloroplast) [Acacia diallaga] CUR01893.1 ycf3 (chloroplast) [Acacia duriuscula] CUR01984.1 ycf3 (chloroplast) [Acacia effusifolia] CUR02075.1 ycf3 (chloroplast) [Acacia effusifolia] CUR02167.1 ycf3 (chloroplast) [Acacia eremaea] CUR02254.1 ycf3 (chloroplast) [Acacia erinacea] CUR02345.1 ycf3 (chloroplast) [Acacia erinacea] CUR02440.1 ycf3 (chloroplast) [Acacia exocarpoides] CUR02552.1 ycf3 (chloroplast) [Acacia exocarpoides] CUR02620.1 ycf3 (chloroplast) [Acacia formidabilis] CUR02711.1 ycf3 (chloroplast) [Acacia fragilis] CUR02894.1 ycf3 (chloroplast) [Acacia hemiteles] CUR02985.1 ycf3 (chloroplast) [Acacia hemiteles] CUR03074.1 ycf3 (chloroplast) [Acacia heteroclita subsp. heteroclita] CUR03165.1 ycf3 (chloroplast) [Acacia inceana subsp. conformis] CUR03255.1 ycf3 (chloroplast) [Acacia inceana subsp. conformis] CUR03345.1 ycf3 (chloroplast) [Acacia jennerae] CUR03436.1 ycf3 (chloroplast) [Acacia jibberdingensis] CUR03527.1 ycf3 (chloroplast) [Acacia jibberdingensis] CUR03619.1 ycf3 (chloroplast) [Acacia karina] CUR03710.1 ycf3 (chloroplast) [Acacia karina] CUR03801.1 ycf3 (chloroplast) [Acacia kochii] CUR03892.1 ycf3 (chloroplast) [Acacia lasiocalyx] CUR03983.1 ycf3 (chloroplast) [Acacia lasiocalyx] CUR04074.1 ycf3 (chloroplast) [Acacia lineolata subsp. lineolata] CUR04165.1 ycf3 (chloroplast) [Acacia longiphyllodinea] CUR04256.1 ycf3 (chloroplast) [Acacia longiphyllodinea] CUR04347.1 ycf3 (chloroplast) [Acacia longispinea] CUR04527.1 ycf3 (chloroplast) [Acacia merrallii] CUR04618.1 ycf3 (chloroplast) [Acacia merrallii] CUR04709.1 ycf3 (chloroplast) [Acacia murrayana] CUR04800.1 ycf3 (chloroplast) [Acacia murrayana] CUR04891.1 ycf3 (chloroplast) [Acacia neurophylla subsp. erugata] CUR04982.1 ycf3 (chloroplast) [Acacia neurophylla subsp. erugata] CUR05073.1 ycf3 (chloroplast) [Acacia obtecta] CUR05165.1 ycf3 (chloroplast) [Acacia oldfieldii] CUR05256.1 ycf3 (chloroplast) [Acacia oldfieldii] CUR05347.1 ycf3 (chloroplast) [Acacia prainii] CUR05438.1 ycf3 (chloroplast) [Acacia puncticulata] CUR05529.1 ycf3 (chloroplast) [Acacia ramulosa var. ramulosa] CUR05620.1 ycf3 (chloroplast) [Acacia resinimarginea] CUR05711.1 ycf3 (chloroplast) [Acacia resinimarginea] CUR05802.1 ycf3 (chloroplast) [Acacia resinimarginea] CUR05893.1 ycf3 (chloroplast) [Acacia resinosa] CUR05984.1 ycf3 (chloroplast) [Acacia resinosa] CUR06075.1 ycf3 (chloroplast) [Acacia restiacea] CUR06165.1 ycf3 (chloroplast) [Acacia restiacea] CUR06255.1 ycf3 (chloroplast) [Acacia rostellifera] CUR06346.1 ycf3 (chloroplast) [Acacia rostellifera] CUR06437.1 ycf3 (chloroplast) [Acacia scalena] CUR06528.1 ycf3 (chloroplast) [Acacia scirpifolia] CUR06619.1 ycf3 (chloroplast) [Acacia scleroclada] CUR06709.1 ycf3 (chloroplast) [Acacia sclerosperma subsp. sclerosperma] CUR06799.1 ycf3 (chloroplast) [Acacia sclerosperma subsp. sclerosperma] CUR06890.1 ycf3 (chloroplast) [Acacia sibina] CUR06982.1 ycf3 (chloroplast) [Acacia stanleyi] CUR07073.1 ycf3 (chloroplast) [Acacia stereophylla var. stereophylla] CUR07164.1 ycf3 (chloroplast) [Acacia sulcaticaulis] CUR07255.1 ycf3 (chloroplast) [Acacia tetragonophylla] CUR07346.1 ycf3 (chloroplast) [Acacia tetragonophylla] CUR07437.1 ycf3 (chloroplast) [Acacia tetragonophylla] CUR07528.1 ycf3 (chloroplast) [Acacia tetragonophylla] CUR07619.1 ycf3 (chloroplast) [Acacia tysonii] CUR07710.1 ycf3 (chloroplast) [Acacia umbraculiformis] CUR07801.1 ycf3 (chloroplast) [Acacia uncinella] CUR07892.1 ycf3 (chloroplast) [Acacia websteri] CUR07983.1 ycf3 (chloroplast) [Acacia woodmaniorum] CUR08072.1 ycf3 (chloroplast) [Acacia xanthina] CUR08161.1 ycf3 (chloroplast) [Acacia xanthina] CUR08252.1 ycf3 (chloroplast) [Acacia yorkrakinensis subsp. acrita] CUR08343.1 ycf3 (chloroplast) [Acacia yorkrakinensis subsp. acrita] CUR08514.1 ycf3 (chloroplast) [Paraserianthes lophantha subsp. lophantha] Length = 168 Score = 102 bits (254), Expect = 3e-24 Identities = 47/48 (97%), Positives = 48/48 (100%) Frame = -3 Query: 574 RGEQAIRQGDSEIAESWFDQAAEYWKQAIALTPGNYIEAQNWLKITGR 431 RGEQAIRQGDSEIAE+WFDQAAEYWKQAIALTPGNYIEAQNWLKITGR Sbjct: 119 RGEQAIRQGDSEIAEAWFDQAAEYWKQAIALTPGNYIEAQNWLKITGR 166