BLASTX nr result
ID: Glycyrrhiza34_contig00029873
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza34_contig00029873 (314 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ERM97418.1 hypothetical protein AMTR_s00251p00013890 [Amborella ... 80 3e-17 ERN18203.1 hypothetical protein AMTR_s00054p00223760, partial [A... 58 4e-09 NP_064043.1 orf112a gene product (mitochondrion) [Beta vulgaris ... 55 1e-07 >ERM97418.1 hypothetical protein AMTR_s00251p00013890 [Amborella trichopoda] Length = 111 Score = 79.7 bits (195), Expect = 3e-17 Identities = 39/57 (68%), Positives = 45/57 (78%) Frame = +2 Query: 140 GIDHYSK*SQAENCCSLERRSAEVVPIIEVRVWD*AFRMIKKKKCLVSLEKPTQISY 310 GIDHYS+ S+AENCCSLER S E +P EVRVWD AF+MIK +K VSL +P QISY Sbjct: 55 GIDHYSQFSKAENCCSLERLSVEGIPTTEVRVWDWAFQMIKTQKFFVSLIEPMQISY 111 >ERN18203.1 hypothetical protein AMTR_s00054p00223760, partial [Amborella trichopoda] Length = 67 Score = 57.8 bits (138), Expect = 4e-09 Identities = 26/33 (78%), Positives = 30/33 (90%) Frame = +2 Query: 143 IDHYSK*SQAENCCSLERRSAEVVPIIEVRVWD 241 IDHYS+ S+AENCCSLE RSA+VVP I+VRVWD Sbjct: 35 IDHYSQFSKAENCCSLECRSAKVVPTIDVRVWD 67 >NP_064043.1 orf112a gene product (mitochondrion) [Beta vulgaris subsp. vulgaris] BAA99353.1 orf112a (mitochondrion) [Beta vulgaris subsp. vulgaris] Length = 112 Score = 55.5 bits (132), Expect = 1e-07 Identities = 25/27 (92%), Positives = 25/27 (92%) Frame = +3 Query: 3 GTYLPPVSISCQVCSPDIDYVQGSTLG 83 GT LPPVSISCQVC PDIDYVQGSTLG Sbjct: 79 GTSLPPVSISCQVCFPDIDYVQGSTLG 105