BLASTX nr result
ID: Glycyrrhiza34_contig00029667
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza34_contig00029667 (254 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value KYP53792.1 Zinc finger with UFM1-specific peptidase domain prote... 124 5e-33 XP_003528008.1 PREDICTED: zinc finger with UFM1-specific peptida... 124 4e-32 KYP72756.1 Zinc finger with UFM1-specific peptidase domain prote... 122 5e-32 XP_017422185.1 PREDICTED: zinc finger with UFM1-specific peptida... 121 3e-31 XP_007136380.1 hypothetical protein PHAVU_009G040600g [Phaseolus... 121 3e-31 XP_013461461.1 zinc finger with UFM1-specific peptidase domain p... 119 4e-31 GAU42574.1 hypothetical protein TSUD_302900 [Trifolium subterran... 119 4e-31 XP_017422184.1 PREDICTED: zinc finger with UFM1-specific peptida... 121 4e-31 XP_017422183.1 PREDICTED: zinc finger with UFM1-specific peptida... 121 4e-31 XP_019415985.1 PREDICTED: zinc finger with UFM1-specific peptida... 120 7e-31 XP_016165427.1 PREDICTED: zinc finger with UFM1-specific peptida... 120 7e-31 XP_004502791.1 PREDICTED: zinc finger with UFM1-specific peptida... 120 7e-31 XP_016165426.1 PREDICTED: zinc finger with UFM1-specific peptida... 120 1e-30 XP_003602444.2 zinc finger with UFM1-specific peptidase domain p... 119 1e-30 KRH72571.1 hypothetical protein GLYMA_02G220600 [Glycine max] KR... 119 2e-30 XP_019459355.1 PREDICTED: zinc finger with UFM1-specific peptida... 120 2e-30 XP_019459354.1 PREDICTED: zinc finger with UFM1-specific peptida... 120 2e-30 XP_014522617.1 PREDICTED: zinc finger with UFM1-specific peptida... 119 2e-30 XP_006575388.1 PREDICTED: zinc finger with UFM1-specific peptida... 119 3e-30 XP_014503978.1 PREDICTED: zinc finger with UFM1-specific peptida... 119 5e-30 >KYP53792.1 Zinc finger with UFM1-specific peptidase domain protein [Cajanus cajan] Length = 288 Score = 124 bits (310), Expect = 5e-33 Identities = 60/67 (89%), Positives = 63/67 (94%) Frame = +2 Query: 2 LLVLDPAHSTAALESSLRQKVGWQKLVKRGMNTLKKPQYQLCYVDPGIASEEEMEKLKTI 181 LLVLDPAHST ALE SLRQKVGW+KLVKRGM+TLKKPQYQLCYVDPGIASEEEM KLKTI Sbjct: 222 LLVLDPAHSTVALEGSLRQKVGWEKLVKRGMHTLKKPQYQLCYVDPGIASEEEMGKLKTI 281 Query: 182 DSIFLEF 202 S+FLEF Sbjct: 282 HSVFLEF 288 >XP_003528008.1 PREDICTED: zinc finger with UFM1-specific peptidase domain protein-like [Glycine max] KHN02138.1 Zinc finger with UFM1-specific peptidase domain protein [Glycine soja] KRH53668.1 hypothetical protein GLYMA_06G139400 [Glycine max] Length = 390 Score = 124 bits (310), Expect = 4e-32 Identities = 59/67 (88%), Positives = 64/67 (95%) Frame = +2 Query: 2 LLVLDPAHSTAALESSLRQKVGWQKLVKRGMNTLKKPQYQLCYVDPGIASEEEMEKLKTI 181 LLVLDPAHST ALE SLR +VGW+KL+KRGM+TLKKPQYQLCYVDPGIASEEEMEKLKTI Sbjct: 324 LLVLDPAHSTDALERSLRLRVGWEKLIKRGMHTLKKPQYQLCYVDPGIASEEEMEKLKTI 383 Query: 182 DSIFLEF 202 DS+FLEF Sbjct: 384 DSVFLEF 390 >KYP72756.1 Zinc finger with UFM1-specific peptidase domain protein [Cajanus cajan] Length = 309 Score = 122 bits (305), Expect = 5e-32 Identities = 58/67 (86%), Positives = 62/67 (92%) Frame = +2 Query: 2 LLVLDPAHSTAALESSLRQKVGWQKLVKRGMNTLKKPQYQLCYVDPGIASEEEMEKLKTI 181 LLVLDPAH TAALE SLR KVGWQK +KRG++TLKKPQYQLCYVDPGIA EEEMEKLKTI Sbjct: 243 LLVLDPAHRTAALERSLRVKVGWQKFIKRGVHTLKKPQYQLCYVDPGIAGEEEMEKLKTI 302 Query: 182 DSIFLEF 202 DS+FLEF Sbjct: 303 DSVFLEF 309 >XP_017422185.1 PREDICTED: zinc finger with UFM1-specific peptidase domain protein-like isoform X3 [Vigna angularis] Length = 374 Score = 121 bits (303), Expect = 3e-31 Identities = 58/67 (86%), Positives = 64/67 (95%) Frame = +2 Query: 2 LLVLDPAHSTAALESSLRQKVGWQKLVKRGMNTLKKPQYQLCYVDPGIASEEEMEKLKTI 181 LL+LDPA STAALE SLRQKVGW++L+KRGM+TLKKPQYQLCYVDPGIASE E+EKLKTI Sbjct: 308 LLILDPAQSTAALERSLRQKVGWEELIKRGMHTLKKPQYQLCYVDPGIASEGEVEKLKTI 367 Query: 182 DSIFLEF 202 DSIFLEF Sbjct: 368 DSIFLEF 374 >XP_007136380.1 hypothetical protein PHAVU_009G040600g [Phaseolus vulgaris] ESW08374.1 hypothetical protein PHAVU_009G040600g [Phaseolus vulgaris] Length = 396 Score = 121 bits (304), Expect = 3e-31 Identities = 59/67 (88%), Positives = 64/67 (95%) Frame = +2 Query: 2 LLVLDPAHSTAALESSLRQKVGWQKLVKRGMNTLKKPQYQLCYVDPGIASEEEMEKLKTI 181 LLVLDPA STAALE SLRQKVGW++L+KRGM+TLKKPQYQLCYVDPGIASE E+EKLKTI Sbjct: 330 LLVLDPAQSTAALERSLRQKVGWEELIKRGMHTLKKPQYQLCYVDPGIASEGEVEKLKTI 389 Query: 182 DSIFLEF 202 DSIFLEF Sbjct: 390 DSIFLEF 396 >XP_013461461.1 zinc finger with UFM1-specific peptidase domain protein [Medicago truncatula] KEH35496.1 zinc finger with UFM1-specific peptidase domain protein [Medicago truncatula] Length = 311 Score = 119 bits (299), Expect = 4e-31 Identities = 57/66 (86%), Positives = 61/66 (92%) Frame = +2 Query: 2 LLVLDPAHSTAALESSLRQKVGWQKLVKRGMNTLKKPQYQLCYVDPGIASEEEMEKLKTI 181 LLVLDPAHSTA LE SL+QK+GWQKL+K+ NTLKKPQYQLCYVDPGIASEEEME LKTI Sbjct: 245 LLVLDPAHSTATLERSLKQKIGWQKLIKKDRNTLKKPQYQLCYVDPGIASEEEMEDLKTI 304 Query: 182 DSIFLE 199 DSIFLE Sbjct: 305 DSIFLE 310 >GAU42574.1 hypothetical protein TSUD_302900 [Trifolium subterraneum] Length = 313 Score = 119 bits (299), Expect = 4e-31 Identities = 56/66 (84%), Positives = 61/66 (92%) Frame = +2 Query: 2 LLVLDPAHSTAALESSLRQKVGWQKLVKRGMNTLKKPQYQLCYVDPGIASEEEMEKLKTI 181 LLVLDP HST ALE SL +K+GWQKL+K+G NTLKKPQYQLCYVDPGIASEEEMEKLKTI Sbjct: 247 LLVLDPTHSTPALERSLMKKIGWQKLIKKGRNTLKKPQYQLCYVDPGIASEEEMEKLKTI 306 Query: 182 DSIFLE 199 DS+FLE Sbjct: 307 DSVFLE 312 >XP_017422184.1 PREDICTED: zinc finger with UFM1-specific peptidase domain protein-like isoform X2 [Vigna angularis] BAT78961.1 hypothetical protein VIGAN_02173000 [Vigna angularis var. angularis] Length = 395 Score = 121 bits (303), Expect = 4e-31 Identities = 58/67 (86%), Positives = 64/67 (95%) Frame = +2 Query: 2 LLVLDPAHSTAALESSLRQKVGWQKLVKRGMNTLKKPQYQLCYVDPGIASEEEMEKLKTI 181 LL+LDPA STAALE SLRQKVGW++L+KRGM+TLKKPQYQLCYVDPGIASE E+EKLKTI Sbjct: 329 LLILDPAQSTAALERSLRQKVGWEELIKRGMHTLKKPQYQLCYVDPGIASEGEVEKLKTI 388 Query: 182 DSIFLEF 202 DSIFLEF Sbjct: 389 DSIFLEF 395 >XP_017422183.1 PREDICTED: zinc finger with UFM1-specific peptidase domain protein-like isoform X1 [Vigna angularis] Length = 396 Score = 121 bits (303), Expect = 4e-31 Identities = 58/67 (86%), Positives = 64/67 (95%) Frame = +2 Query: 2 LLVLDPAHSTAALESSLRQKVGWQKLVKRGMNTLKKPQYQLCYVDPGIASEEEMEKLKTI 181 LL+LDPA STAALE SLRQKVGW++L+KRGM+TLKKPQYQLCYVDPGIASE E+EKLKTI Sbjct: 330 LLILDPAQSTAALERSLRQKVGWEELIKRGMHTLKKPQYQLCYVDPGIASEGEVEKLKTI 389 Query: 182 DSIFLEF 202 DSIFLEF Sbjct: 390 DSIFLEF 396 >XP_019415985.1 PREDICTED: zinc finger with UFM1-specific peptidase domain protein-like [Lupinus angustifolius] XP_019415986.1 PREDICTED: zinc finger with UFM1-specific peptidase domain protein-like [Lupinus angustifolius] XP_019415987.1 PREDICTED: zinc finger with UFM1-specific peptidase domain protein-like [Lupinus angustifolius] XP_019415988.1 PREDICTED: zinc finger with UFM1-specific peptidase domain protein-like [Lupinus angustifolius] XP_019415989.1 PREDICTED: zinc finger with UFM1-specific peptidase domain protein-like [Lupinus angustifolius] OIV96896.1 hypothetical protein TanjilG_00478 [Lupinus angustifolius] Length = 387 Score = 120 bits (301), Expect = 7e-31 Identities = 56/67 (83%), Positives = 64/67 (95%) Frame = +2 Query: 2 LLVLDPAHSTAALESSLRQKVGWQKLVKRGMNTLKKPQYQLCYVDPGIASEEEMEKLKTI 181 LL+LDPAHST ALE SL++KVGWQKL+KRGM+TL++PQYQLCYVDPGIAS EEMEKLKTI Sbjct: 321 LLILDPAHSTVALERSLKEKVGWQKLMKRGMHTLEEPQYQLCYVDPGIASGEEMEKLKTI 380 Query: 182 DSIFLEF 202 DS+FLEF Sbjct: 381 DSVFLEF 387 >XP_016165427.1 PREDICTED: zinc finger with UFM1-specific peptidase domain protein isoform X2 [Arachis ipaensis] Length = 411 Score = 120 bits (302), Expect = 7e-31 Identities = 55/66 (83%), Positives = 64/66 (96%) Frame = +2 Query: 2 LLVLDPAHSTAALESSLRQKVGWQKLVKRGMNTLKKPQYQLCYVDPGIASEEEMEKLKTI 181 LL+LDPAH TA+LE SLR+KVGWQ+LVKRG++TL+KPQYQLCYVDPGIASEEEMEKLKTI Sbjct: 345 LLILDPAHKTASLEKSLREKVGWQRLVKRGIHTLRKPQYQLCYVDPGIASEEEMEKLKTI 404 Query: 182 DSIFLE 199 DS+F+E Sbjct: 405 DSVFIE 410 >XP_004502791.1 PREDICTED: zinc finger with UFM1-specific peptidase domain protein [Cicer arietinum] XP_004502792.1 PREDICTED: zinc finger with UFM1-specific peptidase domain protein [Cicer arietinum] XP_012571992.1 PREDICTED: zinc finger with UFM1-specific peptidase domain protein [Cicer arietinum] Length = 388 Score = 120 bits (301), Expect = 7e-31 Identities = 56/66 (84%), Positives = 61/66 (92%) Frame = +2 Query: 2 LLVLDPAHSTAALESSLRQKVGWQKLVKRGMNTLKKPQYQLCYVDPGIASEEEMEKLKTI 181 LLVLDPAHST ALE SL+QK+GWQKL+K+G NTLKKPQYQLCYVDPGIA EEEME LKTI Sbjct: 322 LLVLDPAHSTTALERSLKQKIGWQKLIKKGRNTLKKPQYQLCYVDPGIAGEEEMETLKTI 381 Query: 182 DSIFLE 199 DS+FLE Sbjct: 382 DSVFLE 387 >XP_016165426.1 PREDICTED: zinc finger with UFM1-specific peptidase domain protein isoform X1 [Arachis ipaensis] Length = 437 Score = 120 bits (302), Expect = 1e-30 Identities = 55/66 (83%), Positives = 64/66 (96%) Frame = +2 Query: 2 LLVLDPAHSTAALESSLRQKVGWQKLVKRGMNTLKKPQYQLCYVDPGIASEEEMEKLKTI 181 LL+LDPAH TA+LE SLR+KVGWQ+LVKRG++TL+KPQYQLCYVDPGIASEEEMEKLKTI Sbjct: 371 LLILDPAHKTASLEKSLREKVGWQRLVKRGIHTLRKPQYQLCYVDPGIASEEEMEKLKTI 430 Query: 182 DSIFLE 199 DS+F+E Sbjct: 431 DSVFIE 436 >XP_003602444.2 zinc finger with UFM1-specific peptidase domain protein [Medicago truncatula] AES72695.2 zinc finger with UFM1-specific peptidase domain protein [Medicago truncatula] Length = 381 Score = 119 bits (299), Expect = 1e-30 Identities = 57/66 (86%), Positives = 61/66 (92%) Frame = +2 Query: 2 LLVLDPAHSTAALESSLRQKVGWQKLVKRGMNTLKKPQYQLCYVDPGIASEEEMEKLKTI 181 LLVLDPAHSTA LE SL+QK+GWQKL+K+ NTLKKPQYQLCYVDPGIASEEEME LKTI Sbjct: 315 LLVLDPAHSTATLERSLKQKIGWQKLIKKDRNTLKKPQYQLCYVDPGIASEEEMEDLKTI 374 Query: 182 DSIFLE 199 DSIFLE Sbjct: 375 DSIFLE 380 >KRH72571.1 hypothetical protein GLYMA_02G220600 [Glycine max] KRH72572.1 hypothetical protein GLYMA_02G220600 [Glycine max] Length = 393 Score = 119 bits (299), Expect = 2e-30 Identities = 56/67 (83%), Positives = 62/67 (92%) Frame = +2 Query: 2 LLVLDPAHSTAALESSLRQKVGWQKLVKRGMNTLKKPQYQLCYVDPGIASEEEMEKLKTI 181 LLV+DP H TAALE SLR+KVGWQK +KRG++TLKK QYQLCYVDPGIASEEEMEKLKTI Sbjct: 327 LLVMDPGHRTAALERSLREKVGWQKFIKRGVHTLKKQQYQLCYVDPGIASEEEMEKLKTI 386 Query: 182 DSIFLEF 202 DS+FLEF Sbjct: 387 DSVFLEF 393 >XP_019459355.1 PREDICTED: zinc finger with UFM1-specific peptidase domain protein-like isoform X2 [Lupinus angustifolius] Length = 459 Score = 120 bits (301), Expect = 2e-30 Identities = 57/67 (85%), Positives = 63/67 (94%) Frame = +2 Query: 2 LLVLDPAHSTAALESSLRQKVGWQKLVKRGMNTLKKPQYQLCYVDPGIASEEEMEKLKTI 181 LL+LDP+H TAALE SLR+KVGWQKLVKRG +TLKK QYQLCYVDPGIAS+EEMEKLKTI Sbjct: 393 LLILDPSHRTAALEKSLREKVGWQKLVKRGTHTLKKAQYQLCYVDPGIASKEEMEKLKTI 452 Query: 182 DSIFLEF 202 DS+FLEF Sbjct: 453 DSVFLEF 459 >XP_019459354.1 PREDICTED: zinc finger with UFM1-specific peptidase domain protein-like isoform X1 [Lupinus angustifolius] Length = 469 Score = 120 bits (301), Expect = 2e-30 Identities = 57/67 (85%), Positives = 63/67 (94%) Frame = +2 Query: 2 LLVLDPAHSTAALESSLRQKVGWQKLVKRGMNTLKKPQYQLCYVDPGIASEEEMEKLKTI 181 LL+LDP+H TAALE SLR+KVGWQKLVKRG +TLKK QYQLCYVDPGIAS+EEMEKLKTI Sbjct: 403 LLILDPSHRTAALEKSLREKVGWQKLVKRGTHTLKKAQYQLCYVDPGIASKEEMEKLKTI 462 Query: 182 DSIFLEF 202 DS+FLEF Sbjct: 463 DSVFLEF 469 >XP_014522617.1 PREDICTED: zinc finger with UFM1-specific peptidase domain protein-like isoform X1 [Vigna radiata var. radiata] Length = 395 Score = 119 bits (298), Expect = 2e-30 Identities = 57/67 (85%), Positives = 63/67 (94%) Frame = +2 Query: 2 LLVLDPAHSTAALESSLRQKVGWQKLVKRGMNTLKKPQYQLCYVDPGIASEEEMEKLKTI 181 LL+LDPA STAALE SLRQKVGW++L+KRGM+TLKKPQYQLCYVDPGIASE E+EKLK I Sbjct: 329 LLILDPAQSTAALERSLRQKVGWEELIKRGMHTLKKPQYQLCYVDPGIASEGEVEKLKAI 388 Query: 182 DSIFLEF 202 DSIFLEF Sbjct: 389 DSIFLEF 395 >XP_006575388.1 PREDICTED: zinc finger with UFM1-specific peptidase domain protein-like isoform X1 [Glycine max] XP_014624528.1 PREDICTED: zinc finger with UFM1-specific peptidase domain protein-like isoform X1 [Glycine max] XP_014624530.1 PREDICTED: zinc finger with UFM1-specific peptidase domain protein-like isoform X1 [Glycine max] KHN46187.1 Zinc finger with UFM1-specific peptidase domain protein [Glycine soja] KRH72573.1 hypothetical protein GLYMA_02G220600 [Glycine max] KRH72574.1 hypothetical protein GLYMA_02G220600 [Glycine max] Length = 431 Score = 119 bits (299), Expect = 3e-30 Identities = 56/67 (83%), Positives = 62/67 (92%) Frame = +2 Query: 2 LLVLDPAHSTAALESSLRQKVGWQKLVKRGMNTLKKPQYQLCYVDPGIASEEEMEKLKTI 181 LLV+DP H TAALE SLR+KVGWQK +KRG++TLKK QYQLCYVDPGIASEEEMEKLKTI Sbjct: 365 LLVMDPGHRTAALERSLREKVGWQKFIKRGVHTLKKQQYQLCYVDPGIASEEEMEKLKTI 424 Query: 182 DSIFLEF 202 DS+FLEF Sbjct: 425 DSVFLEF 431 >XP_014503978.1 PREDICTED: zinc finger with UFM1-specific peptidase domain protein [Vigna radiata var. radiata] Length = 425 Score = 119 bits (297), Expect = 5e-30 Identities = 56/67 (83%), Positives = 62/67 (92%) Frame = +2 Query: 2 LLVLDPAHSTAALESSLRQKVGWQKLVKRGMNTLKKPQYQLCYVDPGIASEEEMEKLKTI 181 LLVLDP H T ALE SL +KVGWQKL+KRG++TLKKPQYQLCYVDPGIASEEEM+KLKTI Sbjct: 359 LLVLDPGHRTGALERSLIEKVGWQKLIKRGVHTLKKPQYQLCYVDPGIASEEEMKKLKTI 418 Query: 182 DSIFLEF 202 DS+FLEF Sbjct: 419 DSVFLEF 425