BLASTX nr result
ID: Glycyrrhiza34_contig00029602
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza34_contig00029602 (448 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_003610808.1 PPR containing plant-like protein [Medicago trunc... 155 5e-41 XP_012574336.1 PREDICTED: pentatricopeptide repeat-containing pr... 122 1e-29 XP_015960897.1 PREDICTED: pentatricopeptide repeat-containing pr... 114 2e-26 XP_016187559.1 PREDICTED: pentatricopeptide repeat-containing pr... 113 2e-26 KHN34133.1 Pentatricopeptide repeat-containing protein, mitochon... 110 2e-25 KRH77788.1 hypothetical protein GLYMA_01G233900, partial [Glycin... 110 2e-25 XP_014617375.1 PREDICTED: LOW QUALITY PROTEIN: pentatricopeptide... 110 2e-25 XP_006590435.1 PREDICTED: pentatricopeptide repeat-containing pr... 108 1e-24 KHN35153.1 Pentatricopeptide repeat-containing protein, mitochon... 107 3e-24 XP_007157080.1 hypothetical protein PHAVU_002G041300g [Phaseolus... 107 3e-24 XP_014501497.1 PREDICTED: pentatricopeptide repeat-containing pr... 105 2e-23 GAU43382.1 hypothetical protein TSUD_254650 [Trifolium subterran... 103 9e-23 XP_017421861.1 PREDICTED: pentatricopeptide repeat-containing pr... 103 9e-23 BAT78613.1 hypothetical protein VIGAN_02131300 [Vigna angularis ... 103 9e-23 XP_019421497.1 PREDICTED: pentatricopeptide repeat-containing pr... 102 1e-22 XP_015887029.1 PREDICTED: pentatricopeptide repeat-containing pr... 100 1e-21 KYP52715.1 hypothetical protein KK1_025460 [Cajanus cajan] 96 2e-20 XP_011026357.1 PREDICTED: pentatricopeptide repeat-containing pr... 96 3e-20 XP_011462603.1 PREDICTED: pentatricopeptide repeat-containing pr... 94 1e-19 OIV94978.1 hypothetical protein TanjilG_22175 [Lupinus angustifo... 94 2e-19 >XP_003610808.1 PPR containing plant-like protein [Medicago truncatula] AES93766.1 PPR containing plant-like protein [Medicago truncatula] Length = 1084 Score = 155 bits (392), Expect = 5e-41 Identities = 92/140 (65%), Positives = 101/140 (72%), Gaps = 1/140 (0%) Frame = -3 Query: 446 NLSHASKVDKALELYASMVSKSVVPELSTLVHLIKGLIKVDKWQEALQLSDSICQMDICW 267 NLSHASKVDKALELYASM+SK+VVPELS LVHLIKGLIKVDKWQEALQLSDSICQMDI W Sbjct: 905 NLSHASKVDKALELYASMISKNVVPELSILVHLIKGLIKVDKWQEALQLSDSICQMDIHW 964 Query: 266 LPEEATSIN*TSVVQVESN*RKMNTGGMEEMVNLVIAIAITEAETGDSEEIFKRCSSYSI 87 L E+A TG EEMV LVIA A+ EAETG SEEI +RCSSYSI Sbjct: 965 LQEKA-------------------TGRTEEMVKLVIA-AMVEAETGVSEEILERCSSYSI 1004 Query: 86 NLQVSKSCVL-LSAYHYITQ 30 N+++ C +HYI Q Sbjct: 1005 NVRI--LCFFGPPIHHYIMQ 1022 >XP_012574336.1 PREDICTED: pentatricopeptide repeat-containing protein At1g06710, mitochondrial [Cicer arietinum] XP_012574337.1 PREDICTED: pentatricopeptide repeat-containing protein At1g06710, mitochondrial [Cicer arietinum] Length = 985 Score = 122 bits (307), Expect = 1e-29 Identities = 62/69 (89%), Positives = 64/69 (92%) Frame = -3 Query: 446 NLSHASKVDKALELYASMVSKSVVPELSTLVHLIKGLIKVDKWQEALQLSDSICQMDICW 267 NLSHASKVDKALELYASM+SK+VVPELS LVHLIKGLIKVDKWQEALQL DSICQMDI W Sbjct: 917 NLSHASKVDKALELYASMISKNVVPELSILVHLIKGLIKVDKWQEALQLLDSICQMDIRW 976 Query: 266 LPEEATSIN 240 L EE TSIN Sbjct: 977 LNEEETSIN 985 >XP_015960897.1 PREDICTED: pentatricopeptide repeat-containing protein At1g06710, mitochondrial [Arachis duranensis] XP_015960902.1 PREDICTED: pentatricopeptide repeat-containing protein At1g06710, mitochondrial [Arachis duranensis] Length = 987 Score = 114 bits (284), Expect = 2e-26 Identities = 56/69 (81%), Positives = 62/69 (89%) Frame = -3 Query: 446 NLSHASKVDKALELYASMVSKSVVPELSTLVHLIKGLIKVDKWQEALQLSDSICQMDICW 267 +LSHASKVDKA ELYASM+SK+VVPELSTLV LIKGL +VDKWQEALQLSDSICQM I W Sbjct: 919 SLSHASKVDKAFELYASMISKNVVPELSTLVDLIKGLTRVDKWQEALQLSDSICQMHIYW 978 Query: 266 LPEEATSIN 240 + EE TS+N Sbjct: 979 VHEEGTSVN 987 >XP_016187559.1 PREDICTED: pentatricopeptide repeat-containing protein At1g06710, mitochondrial [Arachis ipaensis] XP_016187567.1 PREDICTED: pentatricopeptide repeat-containing protein At1g06710, mitochondrial [Arachis ipaensis] XP_016187574.1 PREDICTED: pentatricopeptide repeat-containing protein At1g06710, mitochondrial [Arachis ipaensis] XP_016187583.1 PREDICTED: pentatricopeptide repeat-containing protein At1g06710, mitochondrial [Arachis ipaensis] XP_016187590.1 PREDICTED: pentatricopeptide repeat-containing protein At1g06710, mitochondrial [Arachis ipaensis] XP_016187599.1 PREDICTED: pentatricopeptide repeat-containing protein At1g06710, mitochondrial [Arachis ipaensis] XP_016187608.1 PREDICTED: pentatricopeptide repeat-containing protein At1g06710, mitochondrial [Arachis ipaensis] XP_016187616.1 PREDICTED: pentatricopeptide repeat-containing protein At1g06710, mitochondrial [Arachis ipaensis] XP_016187624.1 PREDICTED: pentatricopeptide repeat-containing protein At1g06710, mitochondrial [Arachis ipaensis] XP_016187630.1 PREDICTED: pentatricopeptide repeat-containing protein At1g06710, mitochondrial [Arachis ipaensis] Length = 987 Score = 113 bits (283), Expect = 2e-26 Identities = 56/69 (81%), Positives = 62/69 (89%) Frame = -3 Query: 446 NLSHASKVDKALELYASMVSKSVVPELSTLVHLIKGLIKVDKWQEALQLSDSICQMDICW 267 +LS ASKVDKA ELYASM+SK+VVPELSTLV LIKGL +VDKWQEALQLSDSICQMDI W Sbjct: 919 SLSQASKVDKAFELYASMISKNVVPELSTLVDLIKGLTRVDKWQEALQLSDSICQMDIYW 978 Query: 266 LPEEATSIN 240 + EE TS+N Sbjct: 979 VHEEGTSVN 987 >KHN34133.1 Pentatricopeptide repeat-containing protein, mitochondrial [Glycine soja] Length = 622 Score = 110 bits (276), Expect = 2e-25 Identities = 54/69 (78%), Positives = 60/69 (86%) Frame = -3 Query: 446 NLSHASKVDKALELYASMVSKSVVPELSTLVHLIKGLIKVDKWQEALQLSDSICQMDICW 267 +LSHASKVDKA ELYASM++ +VVPELST VHLIKGL +V KWQEALQLSDSICQMDI W Sbjct: 554 SLSHASKVDKAFELYASMINNNVVPELSTFVHLIKGLARVGKWQEALQLSDSICQMDIRW 613 Query: 266 LPEEATSIN 240 L EE T+ N Sbjct: 614 LHEEVTNAN 622 >KRH77788.1 hypothetical protein GLYMA_01G233900, partial [Glycine max] Length = 821 Score = 110 bits (276), Expect = 2e-25 Identities = 54/69 (78%), Positives = 60/69 (86%) Frame = -3 Query: 446 NLSHASKVDKALELYASMVSKSVVPELSTLVHLIKGLIKVDKWQEALQLSDSICQMDICW 267 +LSHASKVDKA ELYASM++ +VVPELST VHLIKGL +V KWQEALQLSDSICQMDI W Sbjct: 753 SLSHASKVDKAFELYASMINNNVVPELSTFVHLIKGLARVGKWQEALQLSDSICQMDIRW 812 Query: 266 LPEEATSIN 240 L EE T+ N Sbjct: 813 LHEEVTNAN 821 >XP_014617375.1 PREDICTED: LOW QUALITY PROTEIN: pentatricopeptide repeat-containing protein At1g06710, mitochondrial-like, partial [Glycine max] Length = 888 Score = 110 bits (276), Expect = 2e-25 Identities = 54/69 (78%), Positives = 60/69 (86%) Frame = -3 Query: 446 NLSHASKVDKALELYASMVSKSVVPELSTLVHLIKGLIKVDKWQEALQLSDSICQMDICW 267 +LSHASKVDKA ELYASM++ +VVPELST VHLIKGL +V KWQEALQLSDSICQMDI W Sbjct: 820 SLSHASKVDKAFELYASMINNNVVPELSTFVHLIKGLARVGKWQEALQLSDSICQMDIRW 879 Query: 266 LPEEATSIN 240 L EE T+ N Sbjct: 880 LHEEVTNAN 888 >XP_006590435.1 PREDICTED: pentatricopeptide repeat-containing protein At1g06710, mitochondrial-like [Glycine max] XP_014619231.1 PREDICTED: pentatricopeptide repeat-containing protein At1g06710, mitochondrial-like [Glycine max] XP_014619232.1 PREDICTED: pentatricopeptide repeat-containing protein At1g06710, mitochondrial-like [Glycine max] KRH27688.1 hypothetical protein GLYMA_11G009000 [Glycine max] KRH27689.1 hypothetical protein GLYMA_11G009000 [Glycine max] Length = 968 Score = 108 bits (270), Expect = 1e-24 Identities = 53/64 (82%), Positives = 58/64 (90%) Frame = -3 Query: 446 NLSHASKVDKALELYASMVSKSVVPELSTLVHLIKGLIKVDKWQEALQLSDSICQMDICW 267 +LSHASKVDKA ELYASM++K+VVPELST VHLIKGL +V KWQEALQLSDSICQMDI W Sbjct: 898 SLSHASKVDKAFELYASMINKNVVPELSTFVHLIKGLTRVGKWQEALQLSDSICQMDIHW 957 Query: 266 LPEE 255 L EE Sbjct: 958 LHEE 961 >KHN35153.1 Pentatricopeptide repeat-containing protein, mitochondrial [Glycine soja] Length = 968 Score = 107 bits (267), Expect = 3e-24 Identities = 52/64 (81%), Positives = 58/64 (90%) Frame = -3 Query: 446 NLSHASKVDKALELYASMVSKSVVPELSTLVHLIKGLIKVDKWQEALQLSDSICQMDICW 267 +LSHASKVDKA ELYASM++K++VPELST VHLIKGL +V KWQEALQLSDSICQMDI W Sbjct: 898 SLSHASKVDKAFELYASMINKNMVPELSTFVHLIKGLTRVGKWQEALQLSDSICQMDIHW 957 Query: 266 LPEE 255 L EE Sbjct: 958 LHEE 961 >XP_007157080.1 hypothetical protein PHAVU_002G041300g [Phaseolus vulgaris] XP_007157081.1 hypothetical protein PHAVU_002G041300g [Phaseolus vulgaris] ESW29074.1 hypothetical protein PHAVU_002G041300g [Phaseolus vulgaris] ESW29075.1 hypothetical protein PHAVU_002G041300g [Phaseolus vulgaris] Length = 970 Score = 107 bits (267), Expect = 3e-24 Identities = 52/66 (78%), Positives = 59/66 (89%) Frame = -3 Query: 446 NLSHASKVDKALELYASMVSKSVVPELSTLVHLIKGLIKVDKWQEALQLSDSICQMDICW 267 +LS ASKVDKA ELYASM++K+VVPELST V+LIKGL +V +WQEALQLSDSICQMDICW Sbjct: 902 SLSLASKVDKAFELYASMINKNVVPELSTFVYLIKGLTRVGRWQEALQLSDSICQMDICW 961 Query: 266 LPEEAT 249 L EE T Sbjct: 962 LHEEVT 967 >XP_014501497.1 PREDICTED: pentatricopeptide repeat-containing protein At1g06710, mitochondrial [Vigna radiata var. radiata] XP_014501498.1 PREDICTED: pentatricopeptide repeat-containing protein At1g06710, mitochondrial [Vigna radiata var. radiata] XP_014501499.1 PREDICTED: pentatricopeptide repeat-containing protein At1g06710, mitochondrial [Vigna radiata var. radiata] XP_014501500.1 PREDICTED: pentatricopeptide repeat-containing protein At1g06710, mitochondrial [Vigna radiata var. radiata] XP_014501501.1 PREDICTED: pentatricopeptide repeat-containing protein At1g06710, mitochondrial [Vigna radiata var. radiata] XP_014501502.1 PREDICTED: pentatricopeptide repeat-containing protein At1g06710, mitochondrial [Vigna radiata var. radiata] XP_014501503.1 PREDICTED: pentatricopeptide repeat-containing protein At1g06710, mitochondrial [Vigna radiata var. radiata] Length = 970 Score = 105 bits (261), Expect = 2e-23 Identities = 50/69 (72%), Positives = 60/69 (86%) Frame = -3 Query: 446 NLSHASKVDKALELYASMVSKSVVPELSTLVHLIKGLIKVDKWQEALQLSDSICQMDICW 267 +LS A+KVDKA ELYASM +K+VVPELST V+LIKGL +V +WQEALQLSDSICQMD+CW Sbjct: 902 SLSLANKVDKAFELYASMTNKNVVPELSTFVYLIKGLTRVGRWQEALQLSDSICQMDVCW 961 Query: 266 LPEEATSIN 240 L EE T ++ Sbjct: 962 LHEEITVVD 970 >GAU43382.1 hypothetical protein TSUD_254650 [Trifolium subterraneum] Length = 696 Score = 103 bits (256), Expect = 9e-23 Identities = 50/56 (89%), Positives = 55/56 (98%) Frame = -3 Query: 446 NLSHASKVDKALELYASMVSKSVVPELSTLVHLIKGLIKVDKWQEALQLSDSICQM 279 NLSHASKVD+ALELYASM+SK+VVPELS LVH+IKGLIKVD+WQEALQLSDSICQM Sbjct: 533 NLSHASKVDRALELYASMISKNVVPELSILVHVIKGLIKVDRWQEALQLSDSICQM 588 >XP_017421861.1 PREDICTED: pentatricopeptide repeat-containing protein At1g06710, mitochondrial [Vigna angularis] XP_017421862.1 PREDICTED: pentatricopeptide repeat-containing protein At1g06710, mitochondrial [Vigna angularis] Length = 970 Score = 103 bits (256), Expect = 9e-23 Identities = 50/69 (72%), Positives = 59/69 (85%) Frame = -3 Query: 446 NLSHASKVDKALELYASMVSKSVVPELSTLVHLIKGLIKVDKWQEALQLSDSICQMDICW 267 +LS A+KVD A ELYASM +KSVVPELST V+LIKGL +V +WQEALQLSDSIC+MDICW Sbjct: 902 SLSLANKVDNAFELYASMTNKSVVPELSTFVYLIKGLTRVGRWQEALQLSDSICKMDICW 961 Query: 266 LPEEATSIN 240 L EE T ++ Sbjct: 962 LHEEITVVD 970 >BAT78613.1 hypothetical protein VIGAN_02131300 [Vigna angularis var. angularis] Length = 970 Score = 103 bits (256), Expect = 9e-23 Identities = 50/69 (72%), Positives = 59/69 (85%) Frame = -3 Query: 446 NLSHASKVDKALELYASMVSKSVVPELSTLVHLIKGLIKVDKWQEALQLSDSICQMDICW 267 +LS A+KVD A ELYASM +KSVVPELST V+LIKGL +V +WQEALQLSDSIC+MDICW Sbjct: 902 SLSLANKVDNAFELYASMTNKSVVPELSTFVYLIKGLTRVGRWQEALQLSDSICKMDICW 961 Query: 266 LPEEATSIN 240 L EE T ++ Sbjct: 962 LHEEITVVD 970 >XP_019421497.1 PREDICTED: pentatricopeptide repeat-containing protein At1g06710, mitochondrial [Lupinus angustifolius] XP_019421498.1 PREDICTED: pentatricopeptide repeat-containing protein At1g06710, mitochondrial [Lupinus angustifolius] XP_019421499.1 PREDICTED: pentatricopeptide repeat-containing protein At1g06710, mitochondrial [Lupinus angustifolius] XP_019421500.1 PREDICTED: pentatricopeptide repeat-containing protein At1g06710, mitochondrial [Lupinus angustifolius] Length = 985 Score = 102 bits (255), Expect = 1e-22 Identities = 50/64 (78%), Positives = 58/64 (90%) Frame = -3 Query: 446 NLSHASKVDKALELYASMVSKSVVPELSTLVHLIKGLIKVDKWQEALQLSDSICQMDICW 267 +LS AS+VDKA ELYA M+SK+VVPELST VHLIKGL++VDKWQEAL+LSDSICQM+I W Sbjct: 919 SLSLASRVDKAFELYAIMISKNVVPELSTFVHLIKGLVRVDKWQEALELSDSICQMNIQW 978 Query: 266 LPEE 255 L EE Sbjct: 979 LYEE 982 >XP_015887029.1 PREDICTED: pentatricopeptide repeat-containing protein At1g06710, mitochondrial [Ziziphus jujuba] Length = 1018 Score = 99.8 bits (247), Expect = 1e-21 Identities = 48/67 (71%), Positives = 56/67 (83%) Frame = -3 Query: 446 NLSHASKVDKALELYASMVSKSVVPELSTLVHLIKGLIKVDKWQEALQLSDSICQMDICW 267 +LSHAS VDKA L+A MV++ VPELST +HLIKGL KV+KW+EALQLSDSICQMDI W Sbjct: 951 SLSHASNVDKAFGLFAKMVTRGGVPELSTFIHLIKGLRKVNKWEEALQLSDSICQMDIIW 1010 Query: 266 LPEEATS 246 L +E TS Sbjct: 1011 LQQEETS 1017 >KYP52715.1 hypothetical protein KK1_025460 [Cajanus cajan] Length = 831 Score = 96.3 bits (238), Expect = 2e-20 Identities = 46/56 (82%), Positives = 52/56 (92%) Frame = -3 Query: 446 NLSHASKVDKALELYASMVSKSVVPELSTLVHLIKGLIKVDKWQEALQLSDSICQM 279 +LSHASKVDKA ELYASM++K+VVPELST VHLIKGL +V KWQEALQLSDS+CQM Sbjct: 735 SLSHASKVDKAFELYASMINKNVVPELSTFVHLIKGLTRVGKWQEALQLSDSLCQM 790 >XP_011026357.1 PREDICTED: pentatricopeptide repeat-containing protein At1g06710, mitochondrial [Populus euphratica] Length = 1012 Score = 95.9 bits (237), Expect = 3e-20 Identities = 45/67 (67%), Positives = 55/67 (82%) Frame = -3 Query: 446 NLSHASKVDKALELYASMVSKSVVPELSTLVHLIKGLIKVDKWQEALQLSDSICQMDICW 267 NLS A K DKA ELYA M+S+ +PELS LVHLIKGL++V++W+EALQL DSICQMDI W Sbjct: 943 NLSLAHKADKAFELYADMISRGSIPELSILVHLIKGLLRVNRWEEALQLLDSICQMDIHW 1002 Query: 266 LPEEATS 246 + E+ TS Sbjct: 1003 VQEQETS 1009 >XP_011462603.1 PREDICTED: pentatricopeptide repeat-containing protein At1g06710, mitochondrial isoform X2 [Fragaria vesca subsp. vesca] XP_011462604.1 PREDICTED: pentatricopeptide repeat-containing protein At1g06710, mitochondrial isoform X2 [Fragaria vesca subsp. vesca] XP_011462605.1 PREDICTED: pentatricopeptide repeat-containing protein At1g06710, mitochondrial isoform X2 [Fragaria vesca subsp. vesca] XP_011462606.1 PREDICTED: pentatricopeptide repeat-containing protein At1g06710, mitochondrial isoform X2 [Fragaria vesca subsp. vesca] XP_011462607.1 PREDICTED: pentatricopeptide repeat-containing protein At1g06710, mitochondrial isoform X2 [Fragaria vesca subsp. vesca] XP_011462608.1 PREDICTED: pentatricopeptide repeat-containing protein At1g06710, mitochondrial isoform X2 [Fragaria vesca subsp. vesca] XP_011462609.1 PREDICTED: pentatricopeptide repeat-containing protein At1g06710, mitochondrial isoform X2 [Fragaria vesca subsp. vesca] XP_011462610.1 PREDICTED: pentatricopeptide repeat-containing protein At1g06710, mitochondrial isoform X2 [Fragaria vesca subsp. vesca] XP_011462611.1 PREDICTED: pentatricopeptide repeat-containing protein At1g06710, mitochondrial isoform X2 [Fragaria vesca subsp. vesca] Length = 989 Score = 94.4 bits (233), Expect = 1e-19 Identities = 44/66 (66%), Positives = 53/66 (80%) Frame = -3 Query: 446 NLSHASKVDKALELYASMVSKSVVPELSTLVHLIKGLIKVDKWQEALQLSDSICQMDICW 267 NLSHA+K DKAL+++A M+ PELST HLIKGLIK+++W EALQLSDSICQMDI W Sbjct: 920 NLSHANKADKALQMFAEMIRLGGYPELSTFFHLIKGLIKINRWDEALQLSDSICQMDIQW 979 Query: 266 LPEEAT 249 L +E T Sbjct: 980 LLQEET 985 >OIV94978.1 hypothetical protein TanjilG_22175 [Lupinus angustifolius] Length = 1006 Score = 93.6 bits (231), Expect = 2e-19 Identities = 45/56 (80%), Positives = 52/56 (92%) Frame = -3 Query: 446 NLSHASKVDKALELYASMVSKSVVPELSTLVHLIKGLIKVDKWQEALQLSDSICQM 279 +LS AS+VDKA ELYA M+SK+VVPELST VHLIKGL++VDKWQEAL+LSDSICQM Sbjct: 919 SLSLASRVDKAFELYAIMISKNVVPELSTFVHLIKGLVRVDKWQEALELSDSICQM 974